POGZ Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-83004

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: PEELLTPLAPALPSPASTATPPPTPTHPQALALPPLATEGAECLNVDDQDEGSPVTQEPELASGGGGSGGVGKKEQLSVKKLRVVLFALCCNTEQAAEHFRNPQRRIRRWLRRFQASQGENLEGKYLSFEAEEKLAEWV

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (87%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for POGZ Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: POGZ Antibody [NBP1-83004]

Immunocytochemistry/ Immunofluorescence: POGZ Antibody [NBP1-83004]

Immunocytochemistry/Immunofluorescence: POGZ Antibody [NBP1-83004] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: POGZ Antibody [NBP1-83004]

Immunohistochemistry-Paraffin: POGZ Antibody [NBP1-83004]

Immunohistochemistry-Paraffin: POGZ Antibody [NBP1-83004] - Staining of human testis shows strong nuclear and cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: POGZ Antibody [NBP1-83004]

Immunohistochemistry-Paraffin: POGZ Antibody [NBP1-83004]

Immunohistochemistry-Paraffin: POGZ Antibody [NBP1-83004] - Staining of human cerebral cortex shows moderate to strong nuclear positivity in neurons.
Immunohistochemistry-Paraffin: POGZ Antibody [NBP1-83004]

Immunohistochemistry-Paraffin: POGZ Antibody [NBP1-83004]

Immunohistochemistry-Paraffin: POGZ Antibody [NBP1-83004] - Staining of human placenta shows moderate to strong nuclear positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: POGZ Antibody [NBP1-83004]

Immunohistochemistry-Paraffin: POGZ Antibody [NBP1-83004]

Immunohistochemistry-Paraffin: POGZ Antibody [NBP1-83004] - Staining of human rectum shows moderate to strong nuclear positivity in glandular cells.
POGZ Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: POGZ Antibody - BSA Free [NBP1-83004]

Chromatin Immunoprecipitation-exo-Seq: POGZ Antibody - BSA Free [NBP1-83004]

ChIP-Exo-Seq composite graph for Anti-POGZ (NBP1-83004) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.
POGZ Antibody - BSA Free

Western Blot: POGZ Antibody - BSA Free [NBP1-83004] -

POGZ (GenBank accession number: NM_015100.4) de novo missense variants in neuropsychiatric disorders. (a) Frontal and lateral face photos of the proband reported in this study. (b) Sanger sequencing validated the missense variant is de novo. (c) Immunoblot analysis of POGZ expression in peripheral blood lymphocytes of patient and control. Three independent experiments were performed. Data are means +/- SEM. Differences were statistically significant by Student's t‐test (***p <.001). (d) Location distribution of all reported POGZ de novo missense variants. The novel de novo missense variant identified in this study is marked with red color. (e) Conservation analysis of all reported POGZ de novo missense. The new pathogenic de novo missense variant identified in our study is denoted in red color Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/31347273), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for POGZ Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: POGZ

Pogz is a zinc-finger protein containing at least 8 C2H2 zinc fingers, a CENP-B (centromere protein-B) domain, and a DDE domain found in the bacterial transposase/retroviral integrase family. Members of this family of integrases share structural homologies and show similar catalytic activity to the RAG1 and RAG2 proteins that initiate V(D)J recombination in lymphoid progenitors. Mouse Pogz has a human homolog with a base pair similarity of 90% and amino acid similarity of 93% for the full length protein. In humans at least 3 variants have been predicted and they are all similar at the Nterminus. A number of expressed sequence tags (ESTs) cloned from murine undifferentiated ES cells and Lin-/c-Kit+/Sca-1+ hematopoietic stem cell cDNA libraries correspond to the Pogz gene, further underlining an important function for this gene in stem cells. In mice, deletion of the gene in all tissues early in embryogenesis has been shown to be lethal.

Alternate Names

KIAA0461ZNF635, pogo transposable element with ZNF domain, putative protein product of Nbla00003, SUHW5MGC71543, Suppressor of hairy wing homolog 5, Zinc finger protein 280E, Zinc finger protein 635, ZNF280EZNF635m

Gene Symbol

POGZ

Additional POGZ Products

Product Documents for POGZ Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for POGZ Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for POGZ Antibody - BSA Free

Customer Reviews for POGZ Antibody - BSA Free

There are currently no reviews for this product. Be the first to review POGZ Antibody - BSA Free and earn rewards!

Have you used POGZ Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...