POLDIP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-14147

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (97%), Rat (97%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: RGEDEENREHRVRRIHVRRHITHDERPHGQQIVFKD

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for POLDIP1 Antibody - BSA Free

Immunohistochemistry-Paraffin: POLDIP1 Antibody [NBP2-14147]

Immunohistochemistry-Paraffin: POLDIP1 Antibody [NBP2-14147]

Immunohistochemistry-Paraffin: POLDIP1 Antibody [NBP2-14147] - Staining in human testis and skeletal muscle tissues.. Corresponding KCTD13 RNA-seq data are presented for the same tissues.
Western Blot: POLDIP1 Antibody [NBP2-14147]

Western Blot: POLDIP1 Antibody [NBP2-14147]

Western Blot: POLDIP1 Antibody [NBP2-14147] - Analysis in control (vector only transfected HEK293T lysate) and KCTD13 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: POLDIP1 Antibody [NBP2-14147]

Immunocytochemistry/ Immunofluorescence: POLDIP1 Antibody [NBP2-14147]

Immunocytochemistry/Immunofluorescence: POLDIP1 Antibody [NBP2-14147] - Staining of human cell line A-431 shows localization to nucleus & nuclear bodies. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: POLDIP1 Antibody [NBP2-14147]

Immunohistochemistry-Paraffin: POLDIP1 Antibody [NBP2-14147]

Immunohistochemistry-Paraffin: POLDIP1 Antibody [NBP2-14147] - Staining of human small intestine shows moderate to strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: POLDIP1 Antibody [NBP2-14147]

Immunohistochemistry-Paraffin: POLDIP1 Antibody [NBP2-14147]

Immunohistochemistry-Paraffin: POLDIP1 Antibody [NBP2-14147] - Staining of human cerebral cortex shows moderate to strong nuclear positivity in neurons.
Immunohistochemistry-Paraffin: POLDIP1 Antibody [NBP2-14147]

Immunohistochemistry-Paraffin: POLDIP1 Antibody [NBP2-14147]

Immunohistochemistry-Paraffin: POLDIP1 Antibody [NBP2-14147] - Staining of human skeletal muscle shows very weak positivity in myocytes.
Immunohistochemistry-Paraffin: POLDIP1 Antibody [NBP2-14147]

Immunohistochemistry-Paraffin: POLDIP1 Antibody [NBP2-14147]

Immunohistochemistry-Paraffin: POLDIP1 Antibody [NBP2-14147] - Staining of human prostate shows moderate to strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: POLDIP1 Antibody [NBP2-14147]

Immunohistochemistry-Paraffin: POLDIP1 Antibody [NBP2-14147]

Immunohistochemistry-Paraffin: POLDIP1 Antibody [NBP2-14147] - Staining of human testis shows moderate to strong nuclear positivity in Leydig cells and cells in seminiferous ducts.

Applications for POLDIP1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For ICC/IF Fixation/Permeabilization: PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: POLDIP1

KCTD13 is a gene that codes for a widely expressed protein that functions as a substrate-specific adapter that is involved of the maintenance of the cytoskeleton structure via the regulation of the actin cytoskeleton and cell migrationt that is 329 amino acids long and weighs approximately 36 kDa. Studies are being conducted on diseases and disorders relating to this gene, including microephaly. KCTD13 has also been shown to have interactions with KAT7, LNX1, ZMYND19, ARMC7, and VTA1 in pathways such as the cholera infection, hepatic ABC transporter, PKA signaling, and sweet taste signaling pathways.

Alternate Names

BACURD1, BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 1, BTB/POZ domain-containing protein KCTD13, hBACURD1, PDIP1FKSG86, POLDIP1TNFAIP1-like protein, Polymerase delta-interacting protein 1, potassium channel tetramerisation domain containing 13

Gene Symbol

KCTD13

Additional POLDIP1 Products

Product Documents for POLDIP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for POLDIP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for POLDIP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review POLDIP1 Antibody - BSA Free and earn rewards!

Have you used POLDIP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...