POU3F2/OCT7 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55453

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ASNHYSLLTSSASIVHAEPPGGMQQGAGGYREAQSLVQGDYGALQSNGHP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for POU3F2/OCT7 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: POU3F2/OCT7 Antibody [NBP2-55453]

Immunocytochemistry/ Immunofluorescence: POU3F2/OCT7 Antibody [NBP2-55453]

Immunocytochemistry/Immunofluorescence: POU3F2/OCT7 Antibody [NBP2-55453] - Staining of human cell line AF22 shows localization to nucleus.
POU3F2/OCT7 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: POU3F2/OCT7 Antibody - BSA Free [NBP2-55453]

Chromatin Immunoprecipitation-exo-Seq: POU3F2/OCT7 Antibody - BSA Free [NBP2-55453]

ChIP-Exo-Seq composite graph for Anti-POU3F2 (NBP2-55453) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for POU3F2/OCT7 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: POU3F2

POU3F2 belongs to a large family of transcription factors that bind to the octameric DNA sequence ATGCAAAT. Most of these proteins share a highly homologous region, referred to as the POU domain, that occurs in several mammalian transcription factors, including the octamer-binding proteins Oct1 (POU2F1; MIM 164175) and Oct2 (POU2F2; MIM 164176) and the pituitary protein Pit1 (PIT1; MIM 173110). Class III POU genes are expressed predominantly in the central nervous system (CNS). It is likely that CNS-specific transcription factors such as these play an important role in mammalian neurogenesis by regulating their diverse patterns of gene expression (Schreiber et al., 1993 [PubMed 8441633]; Atanasoski et al., 1995 [PubMed 7601453]).[supplied by OMIM]

Long Name

POU Class 3 Homeobox 2

Alternate Names

Brain-2, BRN2, Oct7, OTF7

Gene Symbol

POU3F2

Additional POU3F2 Products

Product Documents for POU3F2/OCT7 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for POU3F2/OCT7 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for POU3F2/OCT7 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review POU3F2/OCT7 Antibody - BSA Free and earn rewards!

Have you used POU3F2/OCT7 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...