Recombinant Human PPAR alpha/NR1C1 GST (N-Term) Protein
Novus Biologicals | Catalog # H00005465-P01
Key Product Details
Source
Tag
Applications
Product Specifications
Description
Source: Wheat Germ (in vitro)
Amino Acid Sequence: MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFGFTEYQYLGSCPGSDGSVITDTLSPASSPSSVTYPVVPGSVDESPSGALNIECRICGDKASGYHYGVHACEGCKGFFRRTIRLKLVYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGRSHNAIRFGRMPRSEKAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPVGVCGCSGFSWQHGTSVVEDD
Purity
Predicted Molecular Mass
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Activity
Protein / Peptide Type
Scientific Data Images for Recombinant Human PPAR alpha/NR1C1 GST (N-Term) Protein
Formulation, Preparation, and Storage
H00005465-P01
| Preparation Method | in vitro wheat germ expression system |
| Formulation | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -80C. Avoid freeze-thaw cycles. |
Background: PPAR alpha/NR1C1
Long Name
Alternate Names
Gene Symbol
Additional PPAR alpha/NR1C1 Products
Product Documents for Recombinant Human PPAR alpha/NR1C1 GST (N-Term) Protein
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Recombinant Human PPAR alpha/NR1C1 GST (N-Term) Protein
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for Recombinant Human PPAR alpha/NR1C1 GST (N-Term) Protein
Customer Reviews for Recombinant Human PPAR alpha/NR1C1 GST (N-Term) Protein
There are currently no reviews for this product. Be the first to review Recombinant Human PPAR alpha/NR1C1 GST (N-Term) Protein and earn rewards!
Have you used Recombinant Human PPAR alpha/NR1C1 GST (N-Term) Protein?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
FAQs for Recombinant Human PPAR alpha/NR1C1 GST (N-Term) Protein
-
Q: Please differentiate to me between PPAR and PGC clearly. I am confused with the difference between these two
A:
Thank you very much for contacting Novus Biologicals technical support team and sharing your query on the differences between PGC-1 alpha and PPAR. These are two different proteins encoded by their respective genes and serves different functions. PGC-1 alpha (PGC1A or PPAR gamma coactivator 1-alpha) is a transcriptional co-activator for steroid receptors and nuclear receptors, and it regulates diverse aspects of cellular physiology. It up-regulates the transcriptional activity of PPAR-gamma /thyroid hormone receptor on the uncoupling protein promoter; regulates the key mitochondrial genes involved in adaptive thermogenesis; implicates in the metabolic reprogramming in response to nutrients availability through the coordination of the expression of a wide array of genes involved in the regulation of glucose and fatty acid metabolism. Among our PGC-1 alpha antibodies, NBP1-04676 is our best selling product with nice customer feedback and citations in at least 13 research publications. PPAR (PPAR alpha) on the other hand is a ligand-activated transcription factor which gets activated by the endogenous ligand 1-palmitoyl-2-oleoyl-sn-glycerol-3-phosphocholine, and oleylethanolamide (a naturally occurring lipid that regulates satiety), and acts as a key regulator of lipid metabolism. It also acts as a receptor for peroxisome proliferators such as hypolipidemic drugs and fatty acids. It regulates the peroxisomal beta-oxidation pathway of fatty acids, and also functions as transcription activator for the ACOX1 and P450 genes. We have a variety of PPAR alpha antibodies. I hope you will find this information helpful but please let me know if I can support you with anything else from my end. Thank you very much for choosing Novus Biologicals as your quality reagent supplier and we wish you the best with your research projects.