PPIL3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-13794

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: GSQFFITYGKQPHLDMKYTVFGKVIDGLETLDELEKLPVNEKTYRPLNDVHIKDITIHANP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PPIL3 Antibody - BSA Free

Western Blot: PPIL3 Antibody [NBP2-13794]

Western Blot: PPIL3 Antibody [NBP2-13794]

Western Blot: PPIL3 Antibody [NBP2-13794] - Analysis in human cell line HEL.
Immunocytochemistry/ Immunofluorescence: PPIL3 Antibody [NBP2-13794]

Immunocytochemistry/ Immunofluorescence: PPIL3 Antibody [NBP2-13794]

Immunocytochemistry/Immunofluorescence: PPIL3 Antibody [NBP2-13794] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
PPIL3 Antibody - BSA Free Immunohistochemistry-Paraffin: PPIL3 Antibody [NBP2-13794]

Immunohistochemistry-Paraffin: PPIL3 Antibody [NBP2-13794]

Staining of human skeletal muscle shows very weak cytoplasmic positivity in myocytes.
PPIL3 Antibody - BSA Free Immunohistochemistry-Paraffin: PPIL3 Antibody [NBP2-13794]

Immunohistochemistry-Paraffin: PPIL3 Antibody [NBP2-13794]

Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.
PPIL3 Antibody - BSA Free Immunohistochemistry-Paraffin: PPIL3 Antibody [NBP2-13794]

Immunohistochemistry-Paraffin: PPIL3 Antibody [NBP2-13794]

Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
PPIL3 Antibody - BSA Free Immunohistochemistry-Paraffin: PPIL3 Antibody [NBP2-13794]

Immunohistochemistry-Paraffin: PPIL3 Antibody [NBP2-13794]

Staining of human lymph node shows moderate cytoplasmic positivity in germinal and non-germinal center cells.

Applications for PPIL3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PPIL3

PPIL3 encodes a member of the cyclophilin family. Cyclophilins catalyze the cis-trans isomerization of peptidylprolyl imide bonds in oligopeptides. They have been proposed to act either as catalysts or as molecular chaperones in protein-folding events. Transcript variants derived from alternative splicing and/or alternative polyadenylation exist; some of these variants encode different isoforms.

Alternate Names

Cyclophilin J, cyclophilin-like protein 3, Cyclophilin-like protein PPIL3, CyPJ, EC 5.2.1.8, peptidyl-prolyl cis-trans isomerase-like 3, peptidylprolyl cis-trans isomerase-like protein 3, peptidylprolyl isomerase (cyclophilin)-like 3, PPIase, PPIase-like protein 3, Rotamase PPIL3

Gene Symbol

PPIL3

Additional PPIL3 Products

Product Documents for PPIL3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PPIL3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PPIL3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PPIL3 Antibody - BSA Free and earn rewards!

Have you used PPIL3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...