PPIL4 Antibody (1C10) - Azide and BSA Free

Novus Biologicals | Catalog # H00085313-M01

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Knockdown Validated

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 1C10

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

PPIL4 (NP_624311, 395 a.a. ~ 466 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EKEDEDYMPIKNTNQDIYREMGFGHYEEEESCWEKQKSEKRDRTQNRSRSRSRERDGHYSNSHKSKYQTDLY

Reactivity Notes

Human. Other species not tested.

Specificity

PPIL4 - peptidylprolyl isomerase (cyclophilin)-like 4

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Scientific Data Images for PPIL4 Antibody (1C10) - Azide and BSA Free

Western Blot: PPIL4 Antibody (1C10) [H00085313-M01]

Western Blot: PPIL4 Antibody (1C10) [H00085313-M01]

Western Blot: PPIL4 Antibody (1C10) [H00085313-M01] - PPIL4 monoclonal antibody (M01), clone 1C10 Analysis of PPIL4 expression in Hela S3 NE.
Immunocytochemistry/ Immunofluorescence: PPIL4 Antibody (1C10) [H00085313-M01]

Immunocytochemistry/ Immunofluorescence: PPIL4 Antibody (1C10) [H00085313-M01]

Immunocytochemistry/Immunofluorescence: PPIL4 Antibody (1C10) [H00085313-M01] - Analysis of monoclonal antibody to PPIL4 on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: PPIL4 Antibody (1C10) [H00085313-M01]

Western Blot: PPIL4 Antibody (1C10) [H00085313-M01]

Western Blot: PPIL4 Antibody (1C10) [H00085313-M01] - Analysis of PPIL4 over-expressed 293 cell line, cotransfected with PPIL4 Validated Chimera RNAi ( Cat # H00085313-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PPIL4 monoclonal antibody (M01), clone 1C10 (Cat # H00085313-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot: PPIL4 Antibody (1C10) [H00085313-M01]

Western Blot: PPIL4 Antibody (1C10) [H00085313-M01]

Western Blot: PPIL4 Antibody (1C10) [H00085313-M01] - Analysis of PPIL4 expression in transfected 293T cell line by PPIL4 monoclonal antibody (M01), clone 1C10.Lane 1: PPIL4 transfected lysate(57.2 KDa).Lane 2: Non-transfected lysate.

Applications for PPIL4 Antibody (1C10) - Azide and BSA Free

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Immunocytochemistry/ Immunofluorescence

Optimal dilutions of this antibody should be experimentally determined.

Knockdown Validated

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, RNAi validation and ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: PPIL4

This gene is a member of the cyclophilin family of peptidylprolyl isomerases. The cyclophilins are a highly conserved family, members of which play an important role in protein folding, immunosuppression by cyclosporin A, and infection of HIV-1 virions.

Alternate Names

Cyclophilin-like protein PPIL4, cyclophilin-type peptidyl-prolyl cis-trans isomerase, EC 5.2.1.8, HDCME13P, peptidyl-prolyl cis-trans isomerase-like 4, peptidylprolyl isomerase (cyclophilin)-like 4, PPIase, Rotamase PPIL4, serologically defined breast cancer antigen NY-BR-18

Entrez Gene IDs

85313 (Human)

Gene Symbol

PPIL4

OMIM

607609 (Human)

Additional PPIL4 Products

Product Documents for PPIL4 Antibody (1C10) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PPIL4 Antibody (1C10) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PPIL4 Antibody (1C10) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review PPIL4 Antibody (1C10) - Azide and BSA Free and earn rewards!

Have you used PPIL4 Antibody (1C10) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...