PPM1M Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56555

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PPM1M Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: AFQECDEVIGRELEASGQMGGCTALVAVSLQGKLYMANA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PPM1M Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: PPM1M Antibody [NBP2-56555]

Immunocytochemistry/ Immunofluorescence: PPM1M Antibody [NBP2-56555]

Immunocytochemistry/Immunofluorescence: PPM1M Antibody [NBP2-56555] - Staining of human cell line PC-3 shows localization to nuclear bodies.

Applications for PPM1M Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Reviewed Applications

Read 1 review rated 1 using NBP2-56555 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PPM1M

Alternate Names

FLJ32332, PP2CEEC 3.1.3.16, PP2Ceta, PP2C-eta, PPM1E, protein phosphatase 1M, protein phosphatase 1M (PP2C domain containing), protein phosphatase 2C eta, protein phosphatase 2C eta-2, Protein phosphatase 2C isoform eta, protein phosphatase, Mg2+/Mn2+ dependent, 1M

Gene Symbol

PPM1M

Additional PPM1M Products

Product Documents for PPM1M Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PPM1M Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PPM1M Antibody - BSA Free (1)

1 out of 5
1 Customer Rating
5 Stars
0%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
100%

Have you used PPM1M Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 1 of 1 review Showing All
Filter By:
Clear Filters X
  • PPM1M Antibody - BSA Free
    Name: Anonymous
    Application: Immunocytochemistry
    Sample Tested: mouse primary cell and Primary mouse cells
    Species: Mouse
    Verified Customer | Posted 02/28/2025
    PPM1M used at 1:50 in yellow with DAPI in blue. Overnight incubation with the primary in 5% goat serum, 2h incubation with Alexa647 anti-Rabbit secondary. On the left are negative control without primary, on the right with PPM1M 1:50, 60x magnification.
    PPM1M Antibody - BSA Free NBP2-56555
    Bio-Techne Response
    Thank you for reviewing our product. We are sorry to hear that this product did not perform as expected. We have been in touch with the customer to resolve this issue according to our Product Guarantee and to the customer’s satisfaction. This review was for use with mouse primary cells, which Novus lists based on predicted reactivity. Based on the customer's feedback, we have removed mouse reactivity.

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies