PPP2R5D Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-88959
Loading...
Key Product Details
Validated by
Knockout/Knockdown, Independent Antibodies
Species Reactivity
Human, Mouse, Rat
Applications
Knockout Validated, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DCTQQYKAEKQKGRFRMKEREEMWQKIEELARLNPQYPMFRAPPPLPPVYSMETETPTAEDIQLLKRTVETEAVQMLKDIKKEKVLLRRKSELPQDVY
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for PPP2R5D Antibody - BSA Free
Western Blot Shows Human PPP2R5D Specificity Using Knockout Cell Line.
Western blot shows lysates of HAP1 human near-haploid cell line and PPP2R5D knockout HAP1 cell line (KO). Nitrocellulose membrane was probed with PPP2R5D Antibody (Catalog # NBP1-88959) O/N at 4C, followed by HRP-conjugated Secondary Antibody and ECL detection. A specific band was detected for PPP2R5D (as indicated) in the parental HAP1 cell line, but is not detectable in knockout HAP1 cell line. The Ponceau stained transfers of each blot are shown. Image, protocol and testing courtesy of YCharOS Inc. (ycharos.com).Detection of PPP2R5D by Immunoprecipitation.
HAP1 lysates were prepared, and immunoprecipitation was performed using 2.0 ug of PPP2R5D antibody (Catalog # NBP1-88959) pre-coupled to Dynabeads protein A. Samples were washed and processed for Western Blot with PPP2R5D antibody. For Western Blot, Rb x PPP2R5D was used at 1/5000. The Ponceau stained transfers of each blot are shown. SM=4% starting material; UB=4% unbound fraction; IP=immunoprecipitate. Image, protocol and testing courtesy of YCharOS Inc. (ycharos.com).Immunohistochemistry-Paraffin: PPP2R5D Antibody [NBP1-88959]
Immunohistochemistry-Paraffin: PPP2R5D Antibody [NBP1-88959] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.Western Blot: PPP2R5D Antibody [NBP1-88959]
Western Blot: PPP2R5D Antibody [NBP1-88959] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).Applications for PPP2R5D Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:200 - 1:500
Immunohistochemistry-Paraffin
1:200 - 1:500
Knockout Validated
Validated for Knockout from YCharOS Inc. (ycharos.com)
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: PPP2R5D
Alternate Names
MGC2134, MGC8949, PP2A B subunit isoform B56-delta, PP2A B subunit isoform B'-delta, PP2A B subunit isoform PR61-delta, PP2A B subunit isoform R5-delta, PP2A, B subunit, B' delta isoform, PP2A, B subunit, B56 delta isoform, PP2A, B subunit, PR61 delta isoform, PP2A, B subunit, R5 delta isoform, protein phosphatase 2, regulatory subunit B', delta, regulatory subunit B (B56), delta isoform, regulatory subunit B', delta isoform, Serine/threonine protein phosphatase 2A, 56 kDa regulatory subunit, deltaisoform, serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform
Gene Symbol
PPP2R5D
Additional PPP2R5D Products
Product Documents for PPP2R5D Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for PPP2R5D Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for PPP2R5D Antibody - BSA Free
There are currently no reviews for this product. Be the first to review PPP2R5D Antibody - BSA Free and earn rewards!
Have you used PPP2R5D Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...