PREB Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-87057

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: REAHGIVVTDVAFLPEKGRGPELLGSHETALFSVAVDSRCQLHLLPSRRSVP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PREB Antibody - BSA Free

Immunohistochemistry-Paraffin: PREB Antibody [NBP1-87057]

Immunohistochemistry-Paraffin: PREB Antibody [NBP1-87057]

Immunohistochemistry-Paraffin: PREB Antibody [NBP1-87057] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
PREB Antibody - BSA Free Western Blot: PREB Antibody - BSA Free [NBP1-87057]

Western Blot: PREB Antibody - BSA Free [NBP1-87057]

Analysis in human cell line RPMI-8226.
PREB Antibody - BSA Free Western Blot: PREB Antibody - BSA Free [NBP1-87057]

Western Blot: PREB Antibody - BSA Free [NBP1-87057]

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Applications for PREB Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PREB

Prolactin (PRL) expression in the pituitary is limited to specific cells. Pit-1 is a pituitary specific transcription factor that plays an important role in PRL expression, both in mature organism and during development. The PRL promoter contains numerous Pit-1 binding sites and these sites have been implicated in both basal level and kinase-mediated gene expression. The most proximal of these binding sites, termed 1P, has been shown to direct a response to numerous signals, such as cAMP and various G-proteins. A novel protein, termed PREB (prolactin regulatory element binding protein), has been recently identified that regulates PRL gene expression through the 1P site, though it contains no discernable DNA-binding motif. Recent studies suggest that PREB is encoded by a single-copy gene in both mice and humans and exhibits nuclear accumulation in pituitary cells. Evidence suggests that PREB is a novel transcription factor that assists in PRL expression whether alone, or in concert with Pit-1.

Long Name

Prolactin Regulatory Element Binding

Alternate Names

MGC3467, SEC12

Gene Symbol

PREB

Additional PREB Products

Product Documents for PREB Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PREB Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PREB Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PREB Antibody - BSA Free and earn rewards!

Have you used PREB Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...