PRMT2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-52944

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PRMT2 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to PRMT2 (protein arginine methyltransferase 2) The peptide sequence was selected from the N terminal of PRMT2 (NP_001526). Peptide sequence ESQGEEPAECSEAGLLQEGVQPEEFVAIADYAATDETQLSFLRGEKILIL. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

48 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for PRMT2 Antibody - BSA Free

Western Blot: PRMT2 Antibody [NBP1-52944]

Western Blot: PRMT2 Antibody [NBP1-52944]

Western Blot: PRMT2 Antibody [NBP1-52944] - Titration: 0.625ug/ml, Positive Control: Jurkat cell lysate.
Immunohistochemistry: PRMT2 Antibody [NBP1-52944]

Immunohistochemistry: PRMT2 Antibody [NBP1-52944]

Immunohistochemistry: PRMT2 Antibody [NBP1-52944] - Human cardiac cell Cellular data: Epithelial cells of renal tubule Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.
Western Blot: PRMT2 Antibody [NBP1-52944]

Western Blot: PRMT2 Antibody [NBP1-52944]

Western Blot: PRMT2 Antibody [NBP1-52944] - Human LCL and mouse brains at 1:1000.
Immunohistochemistry-Paraffin: PRMT2 Antibody [NBP1-52944]

Immunohistochemistry-Paraffin: PRMT2 Antibody [NBP1-52944]

Immunohistochemistry-Paraffin: PRMT2 Antibody [NBP1-52944] - Human Liver Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Hepatocytes (indicated with arrows) 400X magnification.

Applications for PRMT2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

4-8 ug/ml

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PRMT2

The protein arginine methyltransferases (PRMTs) include a family of proteins with related putative methyltransferase domains that modify chromatin and regulate cellular transcription. PRMT2 inhibits NF-kappaB-dependent transcription and promotes apoptosis and it exerts this effect by blocking nuclear export of IkappaB-alpha through a leptomycin-sensitive pathway, increasing nuclear IkappaB-alpha and decreasing NF-kappaB DNA binding. PRMT2 also rendered cells susceptible to apoptosis by cytokines or cytotoxic drugs, likely due to its effects on NF-kappaB.

Alternate Names

EC 2.1.1.-, EC 2.1.1.125, Histone-arginine N-methyltransferase PRMT2, HMT1, HMT1 (hnRNP methyltransferase, S. cerevisiae)-like 1, HMT1 hnRNP methyltransferase-like 1, HMT1 hnRNP methyltransferase-like 1 (S. cerevisiae), HRMT1L1PRMT2 beta, MGC111373, PRMT2 alpha, PRMT2 gamma, protein arginine methyltransferase 2, protein arginine N-methyltransferase 2

Entrez Gene IDs

3275 (Human)

Gene Symbol

PRMT2

UniProt

P55345 (Human)

Additional PRMT2 Products

Product Documents for PRMT2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PRMT2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for PRMT2 Antibody - BSA Free

Customer Reviews for PRMT2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PRMT2 Antibody - BSA Free and earn rewards!

Have you used PRMT2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies