Prokineticin 2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86756

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Prokineticin 2. Peptide sequence: KSIRICTPMGKLGDSCHPLTRKNNFGNGRQERRKRKRSKRKKEVPFFGRR The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Prokineticin 2 Antibody - BSA Free

Western Blot: Prokineticin 2 Antibody [NBP2-86756]

Western Blot: Prokineticin 2 Antibody [NBP2-86756]

Western Blot: Prokineticin 2 Antibody [NBP2-86756] - WB Suggested Anti-PROK2 Antibody. Titration: 1.0 ug/ml. Positive Control: HT1080 Whole Cell

Applications for Prokineticin 2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Prokineticin 2

Prokineticin 2 is known to regulate many different biological functions, including neurogenesis, smooth muscle contractility, angiogenesis and circadian rhythm. In serving the latter role, prokineticin 2 functions as an output molecule from the suprachiasmatic nucleus (SCN) of the hypothalamus, that transmits behavioral rhythms, but may also function locally within the SCN to synchronize output. Prokineticin 2 expression is induced by CLOCK and BMAL1 heterodimers and light, and is inhibited by period genes (PER1, PER2 and PER3) and cryptochrome genes (CRY1 and CRY2). Expression is reported in the SCN and among a few other discrete brain areas, including the islands of Calleja, media l preoptic area of the hypothalamus and the shell of the nucleus accumbens as well as in the testis, prostate and, at lower levels, in the small intestine.

Long Name

Prokineticin-2

Alternate Names

BV8, PROK2, Protein Bv8 homolog

Gene Symbol

PROK2

Additional Prokineticin 2 Products

Product Documents for Prokineticin 2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Prokineticin 2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Prokineticin 2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Prokineticin 2 Antibody - BSA Free and earn rewards!

Have you used Prokineticin 2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...