Protein Kinase D2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-84139

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: QTWLDLRELEGKMGERYITHESDDARWEQFAAEHPLPGSGLPTDRDLGGACPPQDHDMQGLAERISVL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Protein Kinase D2 Antibody - BSA Free

Western Blot: Protein Kinase D2 Antibody [NBP1-84139]

Western Blot: Protein Kinase D2 Antibody [NBP1-84139]

Western Blot: Protein Kinase D2 Antibody [NBP1-84139] - Analysis using Anti-PRKD2 antibody NBP1-84139 (A) shows similar pattern to independent antibody NBP2-58315 (B).
Immunohistochemistry-Paraffin: Protein Kinase D2 Antibody [NBP1-84139]

Immunohistochemistry-Paraffin: Protein Kinase D2 Antibody [NBP1-84139]

Immunohistochemistry-Paraffin: Protein Kinase D2 Antibody [NBP1-84139] - Staining in human appendix and cerebral cortex tissues using anti-PRKD2 antibody. Corresponding PRKD2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Protein Kinase D2 Antibody [NBP1-84139]

Immunohistochemistry-Paraffin: Protein Kinase D2 Antibody [NBP1-84139]

Immunohistochemistry-Paraffin: Protein Kinase D2 Antibody [NBP1-84139] - Staining of human appendix shows high expression.
Immunohistochemistry-Paraffin: Protein Kinase D2 Antibody [NBP1-84139]

Immunohistochemistry-Paraffin: Protein Kinase D2 Antibody [NBP1-84139]

Immunohistochemistry-Paraffin: Protein Kinase D2 Antibody [NBP1-84139] - Staining of human cerebral cortex shows low expression as expected.

Applications for Protein Kinase D2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PRKD2

Protein kinases constitute a large superfamily of enzymes with key regulatory functions in nearly all signal transmission processes of eukaryotic cells; PKD2 is a novel phorbol ester and growth factor-stimulated protein kinase (1). PKD2 is widely expressed in human and murine tissues and in cell lines such as HL60. In vivo, phorbol ester has been shown to autophosphorylate PKD2 in a synergistic fashion. Phosphorylation of Ser(876) of PKD2 correlated with the activation status of the kinase. The first zinc finger-like domain shares 88% identity to the corresponding domains in PKD/PKC-mu and PKC-nu (2).

Long Name

Protein Kinase D2

Alternate Names

nPKC-D2

Gene Symbol

PRKD2

Additional PRKD2 Products

Product Documents for Protein Kinase D2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Protein Kinase D2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Protein Kinase D2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Protein Kinase D2 Antibody - BSA Free and earn rewards!

Have you used Protein Kinase D2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...

Associated Pathways

VEGF - VEGF R2 Signaling Pathways
VEGF - VEGF R2 Signaling Pathway Thumbnail