Key Product Details
Species Reactivity
Human
Applications
Western Blot
Label
Biotin
Antibody Source
Polyclonal Rabbit IgG
Loading...
Product Specifications
Immunogen
Synthetic peptides corresponding to PSG9(pregnancy specific beta-1-glycoprotein 9) The peptide sequence was selected from the N terminal of PSG9. Peptide sequence YSNASLLIQNVTRKDAGTYTLHIIKRGDETREEIRHFTFTLYLETPKPYI. The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Description
This conjugate is made on demand and is not held in inventory. Each order represents a unique lot. All conjugates are generated using validated conjugation protocols and meet strict degree of labeling (F/P) specifications; additional information is available upon request. The antibody concentration is provided on the individual product label.
For specialized conjugation needs, like large quantities, specific concentrations, and defined F/P ratios, bulk and custom antibody conjugation services are available.
For specialized conjugation needs, like large quantities, specific concentrations, and defined F/P ratios, bulk and custom antibody conjugation services are available.
Applications for PSG9 Antibody [Biotin]
Application
Recommended Usage
Western Blot
Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Recommended applications are based on validated applications from the unconjugated base product NBP1-57676. This conjugated antibody is not kept in inventory and is made to order using validated conjugation protocols.
Formulation, Preparation, and Storage
Purification
Immunogen affinity purified
Formulation
PBS
Preservative
0.05% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C in the dark.
Background: PSG9
Alternate Names
pregnancy specific beta-1-glycoprotein 9, Pregnancy-specific beta-1 glycoprotein B, Pregnancy-specific beta-1-glycoprotein 11, pregnancy-specific beta-1-glycoprotein 9, Pregnancy-specific glycoprotein 11, Pregnancy-specific glycoprotein 7, Pregnancy-specific glycoprotein 9, PS34, PS-beta-B, PS-beta-G-11, PS-beta-G-9, PSBG-11, PSBG-9, PSG11pregnancy specific beta-1-glycoprotein 11, PSG7, PSGII
Gene Symbol
PSG9
Additional PSG9 Products
Product Documents for PSG9 Antibody [Biotin]
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for PSG9 Antibody [Biotin]
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for PSG9 Antibody [Biotin]
There are currently no reviews for this product. Be the first to review PSG9 Antibody [Biotin] and earn rewards!
Have you used PSG9 Antibody [Biotin]?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...