PSMC1 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-80959
Loading...
Key Product Details
Species Reactivity
Validated:
Human, Mouse, Rat
Cited:
Human
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Cited:
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: YDSNSGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDDLIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPE
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
49 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for PSMC1 Antibody - BSA Free
Western Blot: PSMC1 Antibody [NBP1-80959]
Western Blot: PSMC1 Antibody [NBP1-80959] - Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.Immunohistochemistry-Paraffin: PSMC1 Antibody [NBP1-80959]
Immunohistochemistry-Paraffin: PSMC1 Antibody [NBP1-80959] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.Western Blot: PSMC1 Antibody [NBP1-80959]
Western Blot: PSMC1 Antibody [NBP1-80959] - Analysis in human cell line EFO-21.Immunohistochemistry-Paraffin: PSMC1 Antibody [NBP1-80959]
Immunohistochemistry-Paraffin: PSMC1 Antibody [NBP1-80959] - Staining of human prostate shows moderate nuclear positivity in glandular cells.Immunohistochemistry-Paraffin: PSMC1 Antibody [NBP1-80959]
Immunohistochemistry-Paraffin: PSMC1 Antibody [NBP1-80959] - Staining of human skeletal muscle shows moderate nuclear postivity in myocytes.Immunohistochemistry-Paraffin: PSMC1 Antibody [NBP1-80959]
Immunohistochemistry-Paraffin: PSMC1 Antibody [NBP1-80959] - Staining of human pancreas shows moderate nuclear postivity in islets of Langerhans.Western Blot: PSMC1 Antibody [NBP1-80959] -
Western Blot: PSMC1 Antibody [NBP1-80959] - Characterization of potent & selective NMT inhibitors.(a) Structure & dual NMT1/NMT2 inhibitory potency of compound 1. (b) Crystal structure of 1 (grey) bound to NMT1 in the presence of Myr-CoA showing key water molecules (red spheres) & polar interactions (dashed lines). Key residues (NMT1 numbering) are shown for NMT1 (blue, PDB 4C2Y) & NMT2 (pink, PDB 4C2X), & for NMT1 with 1 bound (green, PDB 4C2Z). Myr-CoA or the Myr-CoA analogue (NHM) is shown in black/grey. Image generated in PyMOL (0.99rc6, DeLano Scientific LLC, http://pymol.sourceforge.net/). (c) Viability (MTS assay) of HeLa cells exposed to compound 1 at concentrations & time points indicated; error bars, s.d. (n=6). (d) Compound 1 inhibits NMT activity dose-dependently in HeLa cells (BPD=before pull-down; PD=after pull-down on streptavidin-coated beads). In-gel fluorescence after YnMyr tagging was quantified (ImageJ) & the response (% relative intensity; error bars, s.d. (n=2)) plotted using GraFit 7.0 to determine TC50 (see Fig. 2a for TC50 determined for compound 1). Western blots against protein substrates of NMT show dose-dependent reduction in enrichment following inhibition (tubulin: non-substrate loading control). (e) Cells treated with azidohomoalanine (AHA), cycloheximide (CHX) or inhibitor 1 (or DMSO vehicle), were lysed & ligated (CuAAC) to an alkyne-TAMRA reagent67. In-gel fluorescence demonstrates inhibition of protein synthesis by CHX, but not by 1. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/25255805), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Immunocytochemistry/ Immunofluorescence: PSMC1 Antibody [NBP1-80959]
Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.Applications for PSMC1 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:50 - 1:200
Immunohistochemistry-Paraffin
1:50 - 1:200
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: PSMC1
Alternate Names
26S protease regulatory subunit 4, 26S proteasome AAA-ATPase subunit RPT2, MGC24583, P26S4, p56, proteasome (prosome, macropain) 26S subunit, ATPase, 1, proteasome 26S ATPase subunit 1, Proteasome 26S subunit ATPase 1, proteasome 26S subunit, ATPase, 1, S4MGC8541
Gene Symbol
PSMC1
UniProt
Additional PSMC1 Products
Product Documents for PSMC1 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for PSMC1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for PSMC1 Antibody - BSA Free
Customer Reviews for PSMC1 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review PSMC1 Antibody - BSA Free and earn rewards!
Have you used PSMC1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...