Loading...
Key Product Details
Species Reactivity
Mouse
Applications
Western Blot, Simple Western
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
Synthetic peptide corresponding to a region of Mouse Psmc1 (NP_032973). Peptide sequence ELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDG. The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
48 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Scientific Data Images for PSMC1 Antibody - BSA Free
Western Blot: PSMC1 Antibody [NBP1-91476]
Western Blot: PSMC1 Antibody [NBP1-91476] - Lane 1: 10 ug proteasome fraction from C57B1/6J mouse brain, lane 2: 10 ug proteasome fraction from BLAB/C mouse brain. Primary PSMC1 antibody at 1:500. Secondary antibody: Anti-rabbit HRP antibody at 1:5000.Western Blot: PSMC1 Antibody [NBP1-91476]
Western Blot: PSMC1 Antibody [NBP1-91476] - Mouse Brain lysate, PSMC1 antibody a 1 ug/mL.Simple Western: PSMC1 Antibody [NBP1-91476]
Simple Western: PSMC1 Antibody [NBP1-91476] - Mouse whole spleen lysates at the indicated concentrations were probed with a 1:25 dilution of this PSMC1 antibody. Simple Western image submitted by a verified customer review.Applications for PSMC1 Antibody - BSA Free
Application
Recommended Usage
Simple Western
1:25
Western Blot
1.0 ug/ml
Application Notes
This PSMC1 antibody is validated for Simple Western from a verified customer review.
See Simple Western Antibody Database for Simple Western validation: Tested in Mouse whole spleen lysates, separated by Size, antibody dilution of 1:25
See Simple Western Antibody Database for Simple Western validation: Tested in Mouse whole spleen lysates, separated by Size, antibody dilution of 1:25
Reviewed Applications
Read 1 review rated 4 using NBP1-91476 in the following applications:
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: PSMC1
Alternate Names
26S protease regulatory subunit 4, 26S proteasome AAA-ATPase subunit RPT2, MGC24583, P26S4, p56, proteasome (prosome, macropain) 26S subunit, ATPase, 1, proteasome 26S ATPase subunit 1, Proteasome 26S subunit ATPase 1, proteasome 26S subunit, ATPase, 1, S4MGC8541
Gene Symbol
PSMC1
UniProt
Additional PSMC1 Products
Product Documents for PSMC1 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for PSMC1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for PSMC1 Antibody - BSA Free (1)
4 out of 5
1 Customer Rating
Have you used PSMC1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Customer Images
Showing
1
-
1 of
1 review
Showing All
Filter By:
-
Application: Simple WesternSample Tested: Mouse Spleen LysateSpecies: MouseVerified Customer | Posted 08/23/2019Whole-spleen lysates at the indicated concentrations were probed with a 1:25 dilution of this antibody.
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...