QKI/Quaking Antibody (1D1N6)

Novus Biologicals | Catalog # NBP3-15255

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 1D1N6 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 242-341 of human QKI/Quaking (Q96PU8). RTPTPAGPTIMPLIRQIQTAVMPNGTPHPTAAIVPPGPEAGLIYTPYEYPYTLAPATSILEYPIEPSGVLGAVATKVRRHDMRVHPYQRIVTADRAATGN

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for QKI/Quaking Antibody (1D1N6)

Western Blot: QKI/Quaking Antibody (1D1N6) [NBP3-15255]

Western Blot: QKI/Quaking Antibody (1D1N6) [NBP3-15255]

Western Blot: QKI/Quaking Antibody (1D1N6) [NBP3-15255] - Western blot analysis of extracts of various cell lines, using QKI/Quaking antibody (NBP3-15255) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Immunoprecipitation: QKI/Quaking Antibody (1D1N6) [NBP3-15255]

Immunoprecipitation: QKI/Quaking Antibody (1D1N6) [NBP3-15255]

Immunoprecipitation: QKI/Quaking Antibody (1D1N6) [NBP3-15255] - Immunoprecipitation analysis of 300ug extracts of NIH/3T3 cells using 3ug QKI/Quaking antibody (NBP3-15255). Western blot was performed from the immunoprecipitate using QKI/Quaking antibody (NBP3-15255) at a dilition of 1:1000.
QKI/Quaking Antibody (1D1N6)

Immunohistochemistry: QKI/Quaking Antibody (1D1N6) [NBP3-15255] -

Immunohistochemistry: QKI/Quaking Antibody (1D1N6) [NBP3-15255] - Immunohistochemistry analysis of QKI/Quaking in paraffin-embedded mouse kidney tissue using QKI/Quaking Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
QKI/Quaking Antibody (1D1N6)

Immunohistochemistry: QKI/Quaking Antibody (1D1N6) [NBP3-15255] -

Immunohistochemistry: QKI/Quaking Antibody (1D1N6) [NBP3-15255] - Immunohistochemistry analysis of QKI/Quaking in paraffin-embedded human tonsil tissue using QKI/Quaking Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
QKI/Quaking Antibody (1D1N6)

Immunohistochemistry: QKI/Quaking Antibody (1D1N6) [NBP3-15255] -

Immunohistochemistry: QKI/Quaking Antibody (1D1N6) [NBP3-15255] - Immunohistochemistry analysis of QKI/Quaking in paraffin-embedded human thyroid tissue using QKI/Quaking Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
QKI/Quaking Antibody (1D1N6)

Immunohistochemistry: QKI/Quaking Antibody (1D1N6) [NBP3-15255] -

Immunohistochemistry: QKI/Quaking Antibody (1D1N6) [NBP3-15255] - Immunohistochemistry analysis of QKI/Quaking in paraffin-embedded rat kidney tissue using QKI/Quaking Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
QKI/Quaking Antibody (1D1N6)

Immunohistochemistry: QKI/Quaking Antibody (1D1N6) [NBP3-15255] -

Immunohistochemistry: QKI/Quaking Antibody (1D1N6) [NBP3-15255] - Immunohistochemistry analysis of QKI/Quaking in paraffin-embedded Human lung adenocarcinoma tissue using QKI/Quaking Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
QKI/Quaking Antibody (1D1N6)

Immunohistochemistry: QKI/Quaking Antibody (1D1N6) [NBP3-15255] -

Immunohistochemistry: QKI/Quaking Antibody (1D1N6) [NBP3-15255] - Immunohistochemistry analysis of QKI/Quaking in paraffin-embedded mouse liver tissue using QKI/Quaking Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
QKI/Quaking Antibody (1D1N6)

Immunocytochemistry/ Immunofluorescence: QKI/Quaking Antibody (1D1N6) [NBP3-15255] -

Immunocytochemistry/ Immunofluorescence: QKI/Quaking Antibody (1D1N6) [NBP3-15255] - Immunofluorescence analysis of NIH/3T3 cells using QKI/Quaking Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
QKI/Quaking Antibody (1D1N6)

Immunohistochemistry: QKI/Quaking Antibody (1D1N6) [NBP3-15255] -

Immunohistochemistry: QKI/Quaking Antibody (1D1N6) [NBP3-15255] - Immunohistochemistry analysis of QKI/Quaking in paraffin-embedded human breast cancer tissue using QKI/Quaking Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Applications for QKI/Quaking Antibody (1D1N6)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Immunoprecipitation

1:500 - 1:1000

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: QKI/Quaking

QKI belongs to a family of RNA-binding proteins that have an HNRNPK (MIM 600712) homology (KH) domain embedded in a 200-amino acid region called the GSG domain. Other members of this family include SAM68 (KHDRBS1; MIM 602489) and SF1 (MIM 601516) (Chen and Richard, 1998).[supplied by OMIM]

Alternate Names

DKFZp586I0923, HKQ, homolog of mouse quaking QKI (KH domain RNA binding protein), Hqk, HqkI, protein quaking, QK, QK1, QK3, quaking homolog, KH domain RNA binding (mouse), RNA binding protein HQK

Gene Symbol

QKI

Additional QKI/Quaking Products

Product Documents for QKI/Quaking Antibody (1D1N6)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for QKI/Quaking Antibody (1D1N6)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for QKI/Quaking Antibody (1D1N6)

There are currently no reviews for this product. Be the first to review QKI/Quaking Antibody (1D1N6) and earn rewards!

Have you used QKI/Quaking Antibody (1D1N6)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...