Rad21 Antibody - Azide and BSA Free
Novus Biologicals | Catalog # NBP3-15608
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation, Chromatin Immunoprecipitation (ChIP)
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
Azide and BSA Free
Loading...
Product Specifications
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 281-420 of human Rad21 (NP_006256.1). VDPVEPMPTMTDQTTLVPNEEEAFALEPIDITVKETKAKRKRKLIVDSVKELDSKTIRAQLSDYSDIVTTLDLAPPTKKLMMWKETGGVEKLFSLPAQPLWNNRLLKLFTRCLTPLVPEDLRKRRKGGEADNLDEFLKEF
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Rad21 Antibody - Azide and BSA Free
Western Blot: Rad21 AntibodyAzide and BSA Free [NBP3-15608]
Western Blot: Rad21 Antibody [NBP3-15608] - Western blot analysis of extracts of C6 cells, using Rad21 antibody (NBP3-15608) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 90s.Immunohistochemistry-Paraffin: Rad21 Antibody - Azide and BSA Free [NBP3-15608]
Immunohistochemistry-Paraffin: Rad21 Antibody [NBP3-15608] - Immunohistochemistry of paraffin-embedded rat stomach using Rad21 Rabbit pAb (NBP3-15608) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.Western Blot: Rad21 AntibodyAzide and BSA Free [NBP3-15608]
Western Blot: Rad21 Antibody [NBP3-15608] - Western blot analysis of extracts of various cell lines, using Rad21 antibody (NBP3-15608) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.Immunohistochemistry-Paraffin: Rad21 Antibody - Azide and BSA Free [NBP3-15608]
Immunohistochemistry-Paraffin: Rad21 Antibody [NBP3-15608] - Immunohistochemistry of paraffin-embedded human colon carcinoma using Rad21 Rabbit pAb (NBP3-15608) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.Immunohistochemistry-Paraffin: Rad21 Antibody - Azide and BSA Free [NBP3-15608]
Immunohistochemistry-Paraffin: Rad21 Antibody [NBP3-15608] - Immunohistochemistry of paraffin-embedded mouse stomach using Rad21 Rabbit pAb (NBP3-15608) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.Immunoprecipitation: Rad21 Antibody - Azide and BSA Free [NBP3-15608]
Immunoprecipitation: Rad21 Antibody [NBP3-15608] - Immunoprecipitation analysis of 300ug extracts of Jurkat cells using 3ug Rad21 antibody (NBP3-15608). Western blot was performed from the immunoprecipitate using Rad21 antibody (NBP3-15608) at a dilition of 1:1000.Immunocytochemistry/ Immunofluorescence: Rad21 Antibody - Azide and BSA Free [Rad21] -
Immunocytochemistry/ Immunofluorescence: Rad21 Antibody - Azide and BSA Free [Rad21] - Immunofluorescence analysis of U2OS cells using Rad21 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.Chromatin Immunoprecipitation: Rad21 Antibody - Azide and BSA Free [Rad21] -
Chromatin Immunoprecipitation: Rad21 Antibody - Azide and BSA Free [Rad21] - Chromatin immunoprecipitation analysis of extracts of A-549 cells, using Rad21 antibody and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.Immunoprecipitation: Rad21 Antibody - Azide and BSA Free [Rad21] -
Immunoprecipitation: Rad21 Antibody - Azide and BSA Free [Rad21] - Immunoprecipitation analysis of 300 ug extracts of Jurkat cells using 3 ug Rad21 antibody. Western blot was performed from the immunoprecipitate using Rad21 antibody at a dilution of 1:1000.Chromatin Immunoprecipitation: Rad21 Antibody - Azide and BSA Free [Rad21] -
Chromatin Immunoprecipitation: Rad21 Antibody - Azide and BSA Free [Rad21] - Chromatin immunoprecipitation analysis of extracts of A-549 cells, using Rad21 antibody and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.Applications for Rad21 Antibody - Azide and BSA Free
Application
Recommended Usage
Chromatin Immunoprecipitation (ChIP)
1:500 - 1:1000
Immunocytochemistry/ Immunofluorescence
1:50 - 1:200
Immunohistochemistry
1:50 - 1:200
Immunoprecipitation
1:500 - 1:1000
Western Blot
1:500 - 1:1000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol
Format
Azide and BSA Free
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: Rad21
Alternate Names
double-strand-break repair protein rad21 homolog, hHR21FLJ25655, HR21, KIAA0078RAD21 (S. pombe) homolog, MCD1, Nuclear matrix protein 1, NXP-1, NXP1HRAD21, protein involved in DNA double-strand break repair, RAD21 homolog (S. pombe), SCC1 homolog, SCC1FLJ40596
Gene Symbol
RAD21
Additional Rad21 Products
Product Documents for Rad21 Antibody - Azide and BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Rad21 Antibody - Azide and BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for Rad21 Antibody - Azide and BSA Free
There are currently no reviews for this product. Be the first to review Rad21 Antibody - Azide and BSA Free and earn rewards!
Have you used Rad21 Antibody - Azide and BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- ChIP Protocol Video
- Chromatin Immunoprecipitation (ChIP) Protocol
- Chromatin Immunoprecipitation Protocol
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Immunoprecipitation Protocol
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...