RBBP4/RbAp48 Antibody (0D1X1)

Novus Biologicals | Catalog # NBP3-16237

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 0D1X1 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RBBP4/RbAp48 (NP_005601.1). MADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDS

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for RBBP4/RbAp48 Antibody (0D1X1)

Western Blot: RBBP4/RbAp48 Antibody (0D1X1) [NBP3-16237]

Western Blot: RBBP4/RbAp48 Antibody (0D1X1) [NBP3-16237]

Western Blot: RBBP4/RbAp48 Antibody (0D1X1) [NBP3-16237] - Western blot analysis of extracts of various cell lines, using RBBP4/RbAp48 Rabbit mAb (NBP3-16237) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.
RBBP4/RbAp48 Antibody (0D1X1)

Immunocytochemistry/ Immunofluorescence: RBBP4/RbAp48 Antibody (0D1X1) [NBP3-16237] -

Immunocytochemistry/ Immunofluorescence: RBBP4/RbAp48 Antibody (0D1X1) [NBP3-16237] - Confocal imaging of NIH/3T3 cells using RBBP4/RbAp48 Rabbit mAb. The cells were counterstained with alpha-Tubulin Mouse mAb (Green). DAPI was used for nuclear staining (blue). Objective: 100x.
RBBP4/RbAp48 Antibody (0D1X1)

Immunocytochemistry/ Immunofluorescence: RBBP4/RbAp48 Antibody (0D1X1) [NBP3-16237] -

Immunocytochemistry/ Immunofluorescence: RBBP4/RbAp48 Antibody (0D1X1) [NBP3-16237] - Confocal imaging of U-2 OS cells using RBBP4/RbAp48 Rabbit mAb. The cells were counterstained with alpha-Tubulin Mouse mAb (Green). DAPI was used for nuclear staining (blue). Objective: 100x.
Immunohistochemistry-Paraffin: RBBP4/RbAp48 Antibody (0D1X1) [NBP3-16237]

Immunohistochemistry-Paraffin: RBBP4/RbAp48 Antibody (0D1X1) [NBP3-16237]

Immunohistochemistry-Paraffin: RBBP4/RbAp48 Antibody (0D1X1) [NBP3-16237] - Immunohistochemistry of paraffin-embedded mouse brain using RBBP4/RbAp48 Rabbit mAb (NBP3-16237) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: RBBP4/RbAp48 Antibody (0D1X1) [NBP3-16237]

Immunohistochemistry-Paraffin: RBBP4/RbAp48 Antibody (0D1X1) [NBP3-16237]

Immunohistochemistry-Paraffin: RBBP4/RbAp48 Antibody (0D1X1) [NBP3-16237] - Immunohistochemistry of paraffin-embedded rat brain using RBBP4/RbAp48 Rabbit mAb (NBP3-16237) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: RBBP4/RbAp48 Antibody (0D1X1) [NBP3-16237]

Immunohistochemistry-Paraffin: RBBP4/RbAp48 Antibody (0D1X1) [NBP3-16237]

Immunohistochemistry-Paraffin: RBBP4/RbAp48 Antibody (0D1X1) [NBP3-16237] - Immunohistochemistry of paraffin-embedded human lung cancer using RBBP4/RbAp48 Rabbit mAb (NBP3-16237) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
RBBP4/RbAp48 Antibody (0D1X1)

Immunohistochemistry: RBBP4/RbAp48 Antibody (0D1X1) [NBP3-16237] -

Immunohistochemistry: RBBP4/RbAp48 Antibody (0D1X1) [NBP3-16237] - Immunohistochemistry analysis of paraffin-embedded human breast cancer using RBBP4/RbAp48 Rabbit mAb at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
RBBP4/RbAp48 Antibody (0D1X1)

Immunohistochemistry: RBBP4/RbAp48 Antibody (0D1X1) [NBP3-16237] -

Immunohistochemistry: RBBP4/RbAp48 Antibody (0D1X1) [NBP3-16237] - Immunohistochemistry analysis of paraffin-embedded human tonsil using RBBP4/RbAp48 Rabbit mAb at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
RBBP4/RbAp48 Antibody (0D1X1)

Immunohistochemistry: RBBP4/RbAp48 Antibody (0D1X1) [NBP3-16237] -

Immunohistochemistry: RBBP4/RbAp48 Antibody (0D1X1) [NBP3-16237] - Immunohistochemistry analysis of paraffin-embedded human thyroid cancer using RBBP4/RbAp48 Rabbit mAb at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
RBBP4/RbAp48 Antibody (0D1X1)

Immunohistochemistry: RBBP4/RbAp48 Antibody (0D1X1) [NBP3-16237] -

Immunohistochemistry: RBBP4/RbAp48 Antibody (0D1X1) [NBP3-16237] - Immunohistochemistry analysis of paraffin-embedded rat kidney using RBBP4/RbAp48 Rabbit mAb at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
RBBP4/RbAp48 Antibody (0D1X1)

Immunohistochemistry: RBBP4/RbAp48 Antibody (0D1X1) [NBP3-16237] -

Immunohistochemistry: RBBP4/RbAp48 Antibody (0D1X1) [NBP3-16237] - Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using RBBP4/RbAp48 Rabbit mAb at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
RBBP4/RbAp48 Antibody (0D1X1)

Immunohistochemistry: RBBP4/RbAp48 Antibody (0D1X1) [NBP3-16237] -

Immunohistochemistry: RBBP4/RbAp48 Antibody (0D1X1) [NBP3-16237] - Immunohistochemistry analysis of paraffin-embedded human placenta using RBBP4/RbAp48 Rabbit mAb at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
RBBP4/RbAp48 Antibody (0D1X1)

Immunohistochemistry: RBBP4/RbAp48 Antibody (0D1X1) [NBP3-16237] -

Immunohistochemistry: RBBP4/RbAp48 Antibody (0D1X1) [NBP3-16237] - Immunohistochemistry analysis of paraffin-embedded human kidney using RBBP4/RbAp48 Rabbit mAb at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
RBBP4/RbAp48 Antibody (0D1X1)

Immunohistochemistry: RBBP4/RbAp48 Antibody (0D1X1) [NBP3-16237] -

Immunohistochemistry: RBBP4/RbAp48 Antibody (0D1X1) [NBP3-16237] - Immunohistochemistry analysis of paraffin-embedded human colon using RBBP4/RbAp48 Rabbit mAb at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
RBBP4/RbAp48 Antibody (0D1X1)

Immunohistochemistry: RBBP4/RbAp48 Antibody (0D1X1) [NBP3-16237] -

Immunohistochemistry: RBBP4/RbAp48 Antibody (0D1X1) [NBP3-16237] - Immunohistochemistry analysis of paraffin-embedded human liver using RBBP4/RbAp48 Rabbit mAb at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
RBBP4/RbAp48 Antibody (0D1X1)

Immunohistochemistry: RBBP4/RbAp48 Antibody (0D1X1) [NBP3-16237] -

Immunohistochemistry: RBBP4/RbAp48 Antibody (0D1X1) [NBP3-16237] - Immunohistochemistry analysis of paraffin-embedded mouse liver using RBBP4/RbAp48 Rabbit mAb at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
RBBP4/RbAp48 Antibody (0D1X1)

Immunohistochemistry: RBBP4/RbAp48 Antibody (0D1X1) [NBP3-16237] -

Immunohistochemistry: RBBP4/RbAp48 Antibody (0D1X1) [NBP3-16237] - Immunohistochemistry analysis of paraffin-embedded mouse intestin using RBBP4/RbAp48 Rabbit mAb at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Applications for RBBP4/RbAp48 Antibody (0D1X1)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: RBBP4

RbAp48 encodes a ubiquitously expressed nuclear protein which belongs to a highly conserved subfamily of WD-repeat proteins. It is present in protein complexes involved in histone acetylation and chromatin assembly. It is part of the Mi-2 complex which has been implicated in chromatin remodeling and transcriptional repression associated with histone deacetylation. This encoded protein is also part of co-repressor complexes, which is an integral component of transcriptional silencing. It is found among several cellular proteins that bind directly to retinoblastoma protein to regulate cell proliferation. This protein also seems to be involved in transcriptional repression of E2F-responsive genes.

Long Name

Retinoblastoma Binding Protein 4

Alternate Names

CAF-1 p48, CAF-1C, NURF55, RBAP48

Gene Symbol

RBBP4

Additional RBBP4 Products

Product Documents for RBBP4/RbAp48 Antibody (0D1X1)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RBBP4/RbAp48 Antibody (0D1X1)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RBBP4/RbAp48 Antibody (0D1X1)

There are currently no reviews for this product. Be the first to review RBBP4/RbAp48 Antibody (0D1X1) and earn rewards!

Have you used RBBP4/RbAp48 Antibody (0D1X1)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...