RBP7 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-84383

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: RKIAKLLKPQKVIEQNGDSFTIHTNSSLRNYFVKFKVGEEFDEDNRGLDNRKCKSLVIWDNDRLTCIQKGEK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for RBP7 Antibody - BSA Free

Western Blot: RBP7 Antibody [NBP1-84383]

Western Blot: RBP7 Antibody [NBP1-84383]

Western Blot: RBP7 Antibody [NBP1-84383] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunohistochemistry-Paraffin: RBP7 Antibody [NBP1-84383]

Immunohistochemistry-Paraffin: RBP7 Antibody [NBP1-84383]

Immunohistochemistry-Paraffin: RBP7 Antibody [NBP1-84383] - Staining of human prostate shows moderate nuclear positivity in glandular cells.
Western Blot: RBP7 Antibody [NBP1-84383]

Western Blot: RBP7 Antibody [NBP1-84383]

Western Blot: RBP7 Antibody [NBP1-84383] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: RBP7 Antibody [NBP1-84383]

Immunohistochemistry-Paraffin: RBP7 Antibody [NBP1-84383]

Immunohistochemistry-Paraffin: RBP7 Antibody [NBP1-84383] - Analysis in human breast and pancreas tissues. Corresponding RBP7 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: RBP7 Antibody [NBP1-84383]

Immunohistochemistry-Paraffin: RBP7 Antibody [NBP1-84383]

Immunohistochemistry-Paraffin: RBP7 Antibody [NBP1-84383] - Staining of human breast shows moderate nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: RBP7 Antibody [NBP1-84383]

Immunohistochemistry-Paraffin: RBP7 Antibody [NBP1-84383]

Immunohistochemistry-Paraffin: RBP7 Antibody [NBP1-84383] - Staining of human kidney shows moderate nuclear positivity in cells in tubules and cells in glomeruli.
Immunohistochemistry-Paraffin: RBP7 Antibody [NBP1-84383]

Immunohistochemistry-Paraffin: RBP7 Antibody [NBP1-84383]

Immunohistochemistry-Paraffin: RBP7 Antibody [NBP1-84383] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Applications for RBP7 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200-1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RBP7

Due to its chemical instability and low solubility in aqueous solution, vitamin A requires cellular retinol-binding proteins (CRBPs), such as RBP7, for stability, internalization, intercellular transfer, homeostasis, and metabolism.[supplied by OMIM]

Alternate Names

Cellular retinoic acid-binding protein 4, Cellular retinoic acid-binding protein IV, CRABP4, CRABP-IV, CRBP4, CRBPIV, MGC70641, putative cellular retinol-binding protein CRBP IV, retinoid binding protein 7, retinoid-binding protein 7, retinol binding protein 7, cellular

Gene Symbol

RBP7

Additional RBP7 Products

Product Documents for RBP7 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RBP7 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RBP7 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RBP7 Antibody - BSA Free and earn rewards!

Have you used RBP7 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...