REEP6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-37919

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: MDGLRQRVEHFLEQRNLVTEVLGALEAKTGVEKRYLAAGAVT

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for REEP6 Antibody - BSA Free

Western Blot: REEP6 Antibody [NBP2-37919]

Western Blot: REEP6 Antibody [NBP2-37919]

Western Blot: REEP6 Antibody [NBP2-37919] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue
Immunocytochemistry/ Immunofluorescence: REEP6 Antibody [NBP2-37919]

Immunocytochemistry/ Immunofluorescence: REEP6 Antibody [NBP2-37919]

Immunocytochemistry/Immunofluorescence: REEP6 Antibody [NBP2-37919] - Staining of human cell line Hep G2 shows localization to endoplasmic reticulum.
Immunohistochemistry-Paraffin: REEP6 Antibody [NBP2-37919]

Immunohistochemistry-Paraffin: REEP6 Antibody [NBP2-37919]

Immunohistochemistry-Paraffin: REEP6 Antibody [NBP2-37919] - Analysis in human testis and skeletal muscle tissues using NBP2-37919 antibody. Corresponding REEP6 RNA-seq data are presented for the same tissues.
Immunohistochemistry: REEP6 Antibody [NBP2-37919]

Immunohistochemistry: REEP6 Antibody [NBP2-37919]

Immunohistochemistry: REEP6 Antibody [NBP2-37919] - Staining of human testis shows strong cytoplasmic and membranous positivity.
Immunohistochemistry-Paraffin: REEP6 Antibody [NBP2-37919]

Immunohistochemistry-Paraffin: REEP6 Antibody [NBP2-37919]

Immunohistochemistry-Paraffin: REEP6 Antibody [NBP2-37919] - Staining of human duodenum shows high expression.
Immunohistochemistry-Paraffin: REEP6 Antibody [NBP2-37919]

Immunohistochemistry-Paraffin: REEP6 Antibody [NBP2-37919]

Immunohistochemistry-Paraffin: REEP6 Antibody [NBP2-37919] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: REEP6 Antibody [NBP2-37919]

Immunohistochemistry-Paraffin: REEP6 Antibody [NBP2-37919]

Immunohistochemistry-Paraffin: REEP6 Antibody [NBP2-37919] - Staining of human testis shows strong granular cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: REEP6 Antibody [NBP2-37919]

Immunohistochemistry-Paraffin: REEP6 Antibody [NBP2-37919]

Immunohistochemistry-Paraffin: REEP6 Antibody [NBP2-37919] - Staining of human small intestine shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: REEP6 Antibody [NBP2-37919]

Immunohistochemistry-Paraffin: REEP6 Antibody [NBP2-37919]

Immunohistochemistry-Paraffin: REEP6 Antibody [NBP2-37919] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: REEP6 Antibody [NBP2-37919]

Immunohistochemistry-Paraffin: REEP6 Antibody [NBP2-37919]

Immunohistochemistry-Paraffin: REEP6 Antibody [NBP2-37919] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Applications for REEP6 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: REEP6

REEP6 may enhance the cell surface expression of odorant receptors

Alternate Names

C19orf32deleted in polyposis 1-like 1, DP1L1chromosome 19 open reading frame 32, FLJ25383, Polyposis locus protein 1-like 1, receptor accessory protein 6, receptor expression enhancing protein 6, receptor expression-enhancing protein 6, TB2L1

Gene Symbol

REEP6

UniProt

Additional REEP6 Products

Product Documents for REEP6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for REEP6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for REEP6 Antibody - BSA Free

Customer Reviews for REEP6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review REEP6 Antibody - BSA Free and earn rewards!

Have you used REEP6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...