RGS10 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-55396

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot, Flow Cytometry

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to RGS10 (regulator of G-protein signalling 10) The peptide sequence was selected from the middle region of RGS10. Peptide sequence DQIFNLMKYDSYSRFLKSDLFLKHKRTEEEEEDLPDAQTAAKRASRIYNT. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for RGS10 Antibody - BSA Free

Western Blot: RGS10 Antibody [NBP1-55396]

Western Blot: RGS10 Antibody [NBP1-55396]

Western Blot: RGS10 Antibody [NBP1-55396] - Bone marrow derived monocytes, Antibody Titration: 0.2-1 ug/ml
Flow Cytometry: RGS10 Antibody [NBP1-55396]

Flow Cytometry: RGS10 Antibody [NBP1-55396]

Flow Cytometry: RGS10 Antibody [NBP1-55396] - bone marrow derived monocytes.

Applications for RGS10 Antibody - BSA Free

Application
Recommended Usage

Flow Cytometry

1:10-1:1000

Western Blot

1.0 ug/ml

Flow Cytometry Panel Builder

Bio-Techne Knows Flow Cytometry

Save time and reduce costly mistakes by quickly finding compatible reagents using the Panel Builder Tool.

Advanced Features

  • Spectra Viewer - Custom analysis of spectra from multiple fluorochromes
  • Spillover Popups - Visualize the spectra of individual fluorochromes
  • Antigen Density Selector - Match fluorochrome brightness with antigen density
Build Your Panel Now

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RGS10

RGS10 inhibits signal transduction by increasing the GTPASE activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. It associates specifically with the activated forms of the G protein subunits G(I)-ALPHA and G(Z)- alpha but fails to interact with the structurally and functionally distinct G(S)-alpha subunit. Activity on G(Z)-alpha is inhibited by palmitoylation of the G-protein.

Alternate Names

regulator of G-protein signaling 10, regulator of G-protein signalling 10

Gene Symbol

RGS10

UniProt

Additional RGS10 Products

Product Documents for RGS10 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RGS10 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RGS10 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RGS10 Antibody - BSA Free and earn rewards!

Have you used RGS10 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...