RHCG Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-30905
Loading...
Key Product Details
Validated by
Independent Antibodies
Species Reactivity
Validated:
Human
Cited:
Human
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Cited:
Immunohistochemistry-Paraffin
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: RYDFEADAHWWSERTHKNLSDMENEFYYRYP
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for RHCG Antibody - BSA Free
Western Blot: RHCG Antibody [NBP2-30905]
Western Blot: RHCG Antibody [NBP2-30905] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissueImmunohistochemistry-Paraffin: RHCG Antibody [NBP2-30905]
Immunohistochemistry-Paraffin: RHCG Antibody [NBP2-30905] - Staining of human Pancreas shows no membranous positivity in exocrine glandular cells as expected.Immunohistochemistry-Paraffin: RHCG Antibody [NBP2-30905]
Immunohistochemistry-Paraffin: RHCG Antibody [NBP2-30905] - Staining of human rectum shows low expression as expected.Immunohistochemistry-Paraffin: RHCG Antibody [NBP2-30905]
Immunohistochemistry-Paraffin: RHCG Antibody [NBP2-30905] - Staining of human colon, esophagus, kidney and lymph node using Anti-RHCG antibody NBP2-30905 (A) shows similar protein distribution across tissues to independent antibody NBP2-30825 (B).Immunohistochemistry-Paraffin: RHCG Antibody [NBP2-30905]
Immunohistochemistry-Paraffin: RHCG Antibody [NBP2-30905] - Staining of human lymph node.Immunohistochemistry-Paraffin: RHCG Antibody [NBP2-30905]
Immunohistochemistry-Paraffin: RHCG Antibody [NBP2-30905] - Staining of human kidney.Immunohistochemistry-Paraffin: RHCG Antibody [NBP2-30905]
Immunohistochemistry-Paraffin: RHCG Antibody [NBP2-30905] - Staining of human colon.Immunohistochemistry-Paraffin: RHCG Antibody [NBP2-30905]
Immunohistochemistry-Paraffin: RHCG Antibody [NBP2-30905] - Analysis in human esophagus and pancreas tissues using NBP2-30905 antibody. Corresponding RHCG RNA-seq data are presented for the same tissues.Immunohistochemistry-Paraffin: RHCG Antibody [NBP2-30905]
Immunohistochemistry-Paraffin: RHCG Antibody [NBP2-30905] - Staining of human Esophagus shows strong membranous positivity in squamous epithelial cells.Immunohistochemistry-Paraffin: RHCG Antibody [NBP2-30905]
Immunohistochemistry-Paraffin: RHCG Antibody [NBP2-30905] - Staining of human kidney shows strong membranous positivity in cells in distal tubules.Immunohistochemistry-Paraffin: RHCG Antibody [NBP2-30905]
Immunohistochemistry-Paraffin: RHCG Antibody [NBP2-30905] - Staining of human kidney, lymph node, pancreas and squamous epithelia using Anti-RHCG antibody NBP2-30905 (A) shows similar protein distribution across tissues to independent antibody NBP2-30825 (B).Immunohistochemistry-Paraffin: RHCG Antibody [NBP2-30905]
Immunohistochemistry-Paraffin: RHCG Antibody [NBP2-30905] - Staining of human Lymph node shows no membranous positivity in non-germinal center cells as expected.Immunohistochemistry-Paraffin: RHCG Antibody [NBP2-30905]
Immunohistochemistry-Paraffin: RHCG Antibody [NBP2-30905] - Staining of human Tonsil shows strong membranous positivity in squamous epithelial cells.Applications for RHCG Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:1000 - 1:2500
Immunohistochemistry-Paraffin
1:1000 - 1:2500
Western Blot
1:100 - 1:250
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: RHCG
Alternate Names
ammonium transporter Rh type C, CDRC2, chromosome 15 open reading frame 6, PDRC2C15orf6, Rh family type C glycoprotein, Rh family, C glycoprotein, Rh glycoprotein kidney, Rh type C glycoprotein, Rhesus blood group family type C glycoprotein, Rhesus blood group, C glycoprotein, RHGKTumor-related protein DRC2, SLC42A3
Gene Symbol
RHCG
UniProt
Additional RHCG Products
Product Documents for RHCG Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for RHCG Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for RHCG Antibody - BSA Free
Customer Reviews for RHCG Antibody - BSA Free
There are currently no reviews for this product. Be the first to review RHCG Antibody - BSA Free and earn rewards!
Have you used RHCG Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...