RHOT2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88153

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human RHOT2. Peptide sequence: TIPADVTPEKVPTHIVDYSEAEQTDEELREEIHKANVVCVVYDVSEEATI The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for RHOT2 Antibody - BSA Free

Western Blot: RHOT2 Antibody [NBP2-88153]

Western Blot: RHOT2 Antibody [NBP2-88153]

Western Blot: RHOT2 Antibody [NBP2-88153] - WB Suggested Anti-RHOT2 Antibody. Positive Control: Lane 1: 20ug untransfected HEK293T Lane 2: 20ug RHOT2 transfected HEK293T. Primary Antibody Dilution : 1:1000. Secondary Antibody : Anti-rabbit-HRP. Secondry Antibody Dilution : 1:2000. Submitted by: Jin

Applications for RHOT2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RHOT2

RHOT2 is a gene that codes for a protein that is 618 amino acids long and weighs approximately 68 kDa and has a shorter isoform that is 213 amino acids long and weighs approximately 23 kDa. The protein that RHOT2 codes for is a mitochondrial GTPase that is involved in mitochondrial trafficking as well as the control of the subcellular distribution of mitochondria. Current research is being done on diseases and disorders linked to this gene including hypoxia. RHOT2 has been shown to have interactions with ZFYVE9, RYK, TRAK1, BECN1, and CLN3 in pathways such as the Rho GTPase cycle and signal transduction pathways.

Alternate Names

ARHT2, C16orf39, chromosome 16 open reading frame 39, EC 3.6.5, EC 3.6.5.-, hMiro-2, MIRO-2mitochondrial Rho 2, mitochondrial Rho GTPase 2, Ras homolog gene family member T2, ras homolog gene family, member T2, RASL

Gene Symbol

RHOT2

Additional RHOT2 Products

Product Documents for RHOT2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RHOT2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RHOT2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RHOT2 Antibody - BSA Free and earn rewards!

Have you used RHOT2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...