RNF141 Antibody (6D9) - Azide and BSA Free

Novus Biologicals | Catalog # H00050862-M01

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Sandwich ELISA, Knockdown Validated

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # 6D9

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

RNF141 (NP_001008563, 141 a.a. ~ 229 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LWMGRVKQLTDEEECCICMDGRADLILPCAHSFCQKCIDKWSDRHRNCPICRLQMTGANESWVVSDAPTEDDMANYILNMADEAGQPHR

Reactivity Notes

Human, Mouse, & Rat. Other species not tested.

Specificity

RNF141 - ring finger protein 141

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Scientific Data Images for RNF141 Antibody (6D9) - Azide and BSA Free

Western Blot: RNF141 Antibody (6D9) [H00050862-M01]

Western Blot: RNF141 Antibody (6D9) [H00050862-M01]

Western Blot: RNF141 Antibody (6D9) [H00050862-M01] - RNF141 monoclonal antibody (M01), clone 6D9 Analysis of RNF141 expression in A-431.
Immunohistochemistry-Paraffin: RNF141 Antibody (6D9) [H00050862-M01]

Immunohistochemistry-Paraffin: RNF141 Antibody (6D9) [H00050862-M01]

Immunohistochemistry-Paraffin: RNF141 Antibody (6D9) [H00050862-M01] - Analysis of monoclonal antibody to RNF141 on formalin-fixed paraffin-embedded human testis. Antibody concentration 0.3 ug/ml.
Western Blot: RNF141 Antibody (6D9) [H00050862-M01]

Western Blot: RNF141 Antibody (6D9) [H00050862-M01]

Western Blot: RNF141 Antibody (6D9) [H00050862-M01] - Analysis of RNF141 over-expressed 293 cell line, cotransfected with RNF141 Validated Chimera RNAi ( Cat # H00050862-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with RNF141 monoclonal antibody (M01), clone 6D9 (Cat # H00050862-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot: RNF141 Antibody (6D9) [H00050862-M01]

Western Blot: RNF141 Antibody (6D9) [H00050862-M01]

Western Blot: RNF141 Antibody (6D9) [H00050862-M01] - RNF141 monoclonal antibody (M01), clone 6D9. Analysis of RNF141 expression in PC-12.
Western Blot: RNF141 Antibody (6D9) [H00050862-M01]

Western Blot: RNF141 Antibody (6D9) [H00050862-M01]

Western Blot: RNF141 Antibody (6D9) [H00050862-M01] - RNF141 monoclonal antibody (M01), clone 6D9. Analysis of RNF141 expression in Raw 264.7.
Western Blot: RNF141 Antibody (6D9) [H00050862-M01]

Western Blot: RNF141 Antibody (6D9) [H00050862-M01]

Western Blot: RNF141 Antibody (6D9) [H00050862-M01] - Analysis of RNF141 expression in transfected 293T cell line by RNF141 monoclonal antibody (M01), clone 6D9.Lane 1: RNF141 transfected lysate(25.5 KDa).Lane 2: Non-transfected lysate.
Sandwich ELISA: RNF141 Antibody (6D9) [H00050862-M01] - Detection limit for recombinant GST tagged RNF141 is approximately 0.03ng/ml as a capture antibody.

Applications for RNF141 Antibody (6D9) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin), RNAi validation, and ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: RNF141

The protein encoded by this gene contains a RING finger, a motif known to be involved in protein-DNA and protein-protein interactions. Abundant expression of this gene was found in the testicular tissue of fertile men, but was not detected in azoospermic patients. Studies of the mouse counterpart suggest that this gene may function as a testis specific transcription factor during spermatogenesis.

Alternate Names

C3HC4-like zinc finger protein, MGC8715, ring finger protein 141, Zinc finger protein 230, ZNF230ZFP26

Entrez Gene IDs

50862 (Human)

Gene Symbol

RNF141

Additional RNF141 Products

Product Documents for RNF141 Antibody (6D9) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RNF141 Antibody (6D9) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RNF141 Antibody (6D9) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review RNF141 Antibody (6D9) - Azide and BSA Free and earn rewards!

Have you used RNF141 Antibody (6D9) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...