RPL35 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-15546

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 50-120 of human RPL35 (NP_009140.1). VRKSIARVLTVINQTQKENLRKFYKGKKYKPLDLRPKKTRAMRRRLNKHEENLKTKKQQRKERLYPLRKYA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for RPL35 Antibody - Azide and BSA Free

Western Blot: RPL35 AntibodyAzide and BSA Free [NBP3-15546]

Western Blot: RPL35 AntibodyAzide and BSA Free [NBP3-15546]

Western Blot: RPL35 Antibody [NBP3-15546] - Western blot analysis of extracts of various cell lines, using RPL35 Rabbit pAb (NBP3-15546) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.
Immunocytochemistry/ Immunofluorescence: RPL35 Antibody - Azide and BSA Free [NBP3-15546]

Immunocytochemistry/ Immunofluorescence: RPL35 Antibody - Azide and BSA Free [NBP3-15546]

Immunocytochemistry/Immunofluorescence: RPL35 Antibody [NBP3-15546] - Immunofluorescence analysis of L929 cells using RPL35 antibody (NBP3-15546) at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: RPL35 Antibody - Azide and BSA Free [NBP3-15546]

Immunohistochemistry-Paraffin: RPL35 Antibody - Azide and BSA Free [NBP3-15546]

Immunohistochemistry-Paraffin: RPL35 Antibody [NBP3-15546] - Immunohistochemistry of paraffin-embedded Human colon carcinoma using RPL35 Rabbit pAb (NBP3-15546) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Applications for RPL35 Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: RPL35

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L29P family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. (provided by RefSeq)

Alternate Names

M, ribosomal protein L35,60S ribosomal protein L35

Gene Symbol

RPL35

Additional RPL35 Products

Product Documents for RPL35 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RPL35 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for RPL35 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review RPL35 Antibody - Azide and BSA Free and earn rewards!

Have you used RPL35 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...