RPL39L Antibody (4A8-1B6) - Azide and BSA Free

Novus Biologicals | Catalog # H00116832-M01

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Sandwich ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # 4A8-1B6

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

RPL39L (AAH12328, 1 a.a. ~ 51 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSSHKTFTIKRFLAKKQKQNRPIPQWIQMKPGSKIRYNSKRRHWRRTKLGL

Reactivity Notes

Human. Other species not tested.

Specificity

RPL39L - ribosomal protein L39-like

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Scientific Data Images for RPL39L Antibody (4A8-1B6) - Azide and BSA Free

Western Blot: RPL39L Antibody (4A8-1B6) [H00116832-M01]

Western Blot: RPL39L Antibody (4A8-1B6) [H00116832-M01]

Western Blot: RPL39L Antibody (4A8-1B6) [H00116832-M01] - RPL39L monoclonal antibody (M01), clone 4A8-1B6 Analysis of RPL39L expression in HL-60.
Immunohistochemistry-Paraffin: RPL39L Antibody (4A8-1B6) [H00116832-M01]

Immunohistochemistry-Paraffin: RPL39L Antibody (4A8-1B6) [H00116832-M01]

Immunohistochemistry-Paraffin: RPL39L Antibody (4A8-1B6) [H00116832-M01] - Analysis of monoclonal antibody to RPL39L on formalin-fixed paraffin-embedded human ovary, clear cell carcinoma tissue. Antibody concentration 1 ug/ml.
Sandwich ELISA: RPL39L Antibody (4A8-1B6) [H00116832-M01] - Detection limit for recombinant GST tagged RPL39L is approximately 0.1ng/ml as a capture antibody.

Applications for RPL39L Antibody (4A8-1B6) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: RPL39L

This gene encodes a protein sharing high sequence similarity with ribosomal protein L39. Although the name of this gene has been referred to as 'ribosomal protein L39' in the public databases, its official name is 'ribosomal protein L39-like'. It is not currently known whether the encoded protein is a functional ribosomal protein or whether it has evolved a function that is independent of the ribosome.

Alternate Names

60S ribosomal protein L39-like, L39-2, ribosomal protein L39-like, ribosomal protein L39-like 1,60S ribosomal protein L39-2, ribosomal protein L39-like protein, RPL39L1

Entrez Gene IDs

116832 (Human)

Gene Symbol

RPL39L

OMIM

607547 (Human)

Additional RPL39L Products

Product Documents for RPL39L Antibody (4A8-1B6) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RPL39L Antibody (4A8-1B6) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RPL39L Antibody (4A8-1B6) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review RPL39L Antibody (4A8-1B6) - Azide and BSA Free and earn rewards!

Have you used RPL39L Antibody (4A8-1B6) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...