RPS14 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57365

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to RPS14 (ribosomal protein S14) The peptide sequence was selected from the middle region of RPS14. Peptide sequence GNRTKTPGPGAQSALRALARSGMKIGRIEDVTPIPSDSTRRKGGRRGRRL. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for RPS14 Antibody - BSA Free

Western Blot: RPS14 Antibody [NBP1-57365]

Western Blot: RPS14 Antibody [NBP1-57365]

Western Blot: RPS14 Antibody [NBP1-57365] - Jurkat, Antibody Dilution: 1.0 ug/ml RPS14 is supported by BioGPS gene expression data to be expressed in Jurkat.
Western Blot: RPS14 Antibody [NBP1-57365]

Western Blot: RPS14 Antibody [NBP1-57365]

Western Blot: RPS14 Antibody [NBP1-57365] - Titration: 2.5ug/ml, Positive Control: HepG2 cell lysate.
Western Blot: RPS14 Antibody [NBP1-57365]

Western Blot: RPS14 Antibody [NBP1-57365]

Western Blot: RPS14 Antibody [NBP1-57365] - Analysis of 721_B cell lysate. Antibody Dilution: 1.0 ug/ml RPS14 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.
Western Blot: RPS14 Antibody [NBP1-57365]

Western Blot: RPS14 Antibody [NBP1-57365]

Western Blot: RPS14 Antibody [NBP1-57365] - Hela, Antibody Dilution: 1.0 ug/ml RPS14 is supported by BioGPS gene expression data to be expressed in HeLa.
Western Blot: RPS14 Antibody [NBP1-57365]

Western Blot: RPS14 Antibody [NBP1-57365]

Western Blot: RPS14 Antibody [NBP1-57365] - Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.
Western Blot: RPS14 Antibody [NBP1-57365]

Western Blot: RPS14 Antibody [NBP1-57365]

Western Blot: RPS14 Antibody [NBP1-57365] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.
Western Blot: RPS14 Antibody [NBP1-57365]

Western Blot: RPS14 Antibody [NBP1-57365]

Western Blot: RPS14 Antibody [NBP1-57365] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.
Western Blot: RPS14 Antibody [NBP1-57365]

Western Blot: RPS14 Antibody [NBP1-57365]

Western Blot: RPS14 Antibody [NBP1-57365] - MCF7, Antibody Dilution: 1.0 ug/ml RPS14 is supported by BioGPS gene expression data to be expressed in MCF7.

Applications for RPS14 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RPS14

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPS14 is a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S11P family of ribosomal proteins. It is located in the cytoplasm. In Chinese hamster ovary cells, mutations in this gene can lead to resistance to emetine, a protein synthesis inhibitor.Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S11P family of ribosomal proteins. It is located in the cytoplasm. Transcript variants utilizing alternative transcription initiation sites have been described in the literature. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. In Chinese hamster ovary cells, mutations in this gene can lead to resistance to emetine, a protein synthesis inhibitor. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene.

Alternate Names

emetine resistance, EMTB40S ribosomal protein S14, ribosomal protein S14

Gene Symbol

RPS14

UniProt

Additional RPS14 Products

Product Documents for RPS14 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RPS14 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RPS14 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RPS14 Antibody - BSA Free and earn rewards!

Have you used RPS14 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...