RPS19 Antibody (4V3S7)

Novus Biologicals | Catalog # NBP3-16244

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 4V3S7 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 66-145 of human RPS19 (P39019). LRGGAGVGSMTKIYGGRQRNGVMPSHFSRGSKSVARRVLQALEGLKMVEKDQDGGRKLTPQGQRDLDRIAGQVAAANKKH

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for RPS19 Antibody (4V3S7)

Western Blot: RPS19 Antibody (4V3S7) [NBP3-16244]

Western Blot: RPS19 Antibody (4V3S7) [NBP3-16244]

Western Blot: RPS19 Antibody (4V3S7) [NBP3-16244] - Western blot analysis of extracts of various cell lines, using RPS19 Rabbit mAb (NBP3-16244) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
RPS19 Antibody (4V3S7)

Immunocytochemistry/ Immunofluorescence: RPS19 Antibody (4V3S7) [NBP3-16244] -

Immunocytochemistry/ Immunofluorescence: RPS19 Antibody (4V3S7) [NBP3-16244] - Confocal imaging of C6 cells using RPS19 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L).The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green).DAPI was used for nuclear staining (Blue). Objective: 100x.
RPS19 Antibody (4V3S7)

Immunocytochemistry/ Immunofluorescence: RPS19 Antibody (4V3S7) [NBP3-16244] -

Immunocytochemistry/ Immunofluorescence: RPS19 Antibody (4V3S7) [NBP3-16244] - Confocal imaging of paraffin-embedded Human testis using RPS19 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L).DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citRate buffer (pH 6.0) prior to IF staining.
RPS19 Antibody (4V3S7)

Immunoprecipitation: RPS19 Antibody (4V3S7) [NBP3-16244] -

Immunoprecipitation: RPS19 Antibody (4V3S7) [NBP3-16244] - Immunoprecipitation of RPS19 in 300 ug extracts from 293F cells using 3 ug RPS19 Rabbit mAb. Western blot analysis was performed using RPS19 Rabbit mAb at 1:1000 dilution.

Applications for RPS19 Antibody (4V3S7)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: RPS19

RPS19 is required for pre-rRNA processing and maturation of 40S ribosomal subunits.

Alternate Names

DBADBA1,40S ribosomal protein S19, ribosomal protein S19

Gene Symbol

RPS19

Additional RPS19 Products

Product Documents for RPS19 Antibody (4V3S7)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RPS19 Antibody (4V3S7)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RPS19 Antibody (4V3S7)

There are currently no reviews for this product. Be the first to review RPS19 Antibody (4V3S7) and earn rewards!

Have you used RPS19 Antibody (4V3S7)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...