RRBP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-36709

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human RRBP1 (NP_004578.2).

Sequence:
MDIYDTQTLGVVVFGGFMVVSAIGIFLVSTFSMKETSYEEALANQRKEMAKTHHQKVEKKKKEKTVEKKGKTKKKEEKPNGKIPDHDPAPNVTVLLREPVRAPAVAVAPTPVQPPIIVAPVATVPAMPQEKLASSPKDKK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

152 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for RRBP1 Antibody - BSA Free

RRBP1 Antibody

Western Blot: RRBP1 Antibody [NBP3-36709] -

Western Blot: RRBP1 Antibody [NBP3-36709] - Western blot analysis of various lysates using RRBP1 Rabbit pAb at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 1s.
RRBP1 Antibody

Immunocytochemistry/ Immunofluorescence: RRBP1 Antibody [NBP3-36709] -

Immunocytochemistry/ Immunofluorescence: RRBP1 Antibody [NBP3-36709] - Confocal immunofluorescence analysis of HeLa cells using RRBP1 Rabbit pAb at dilution of 1:100. Blue: DAPI for nuclear staining.

Applications for RRBP1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: RRBP1

Analysis of cDNA clones indicates that ribosome binding protein 1 may exist in different forms due to removal of tandem repeats, or partial intraexonic splicing of RRBP1. The form presented here is lacking the canine p180 ribosome-binding domain, NQGKKAEGAQ, which is tandemly repeated close to the N-terminus in other forms that haven't been fully characterized. RRBP1 has been excluded as a candidate gene in the cause of Alagille syndrome. Alternate splicing results in multiple transcript variants. (provided by RefSeq)

Alternate Names

180 kDa ribosome receptor homolog, DKFZp586A1420, ES/130, ES/130-related protein, ES130, FLJ36146, hES, KIAA1398, MGC157720, MGC157721, ribosome binding protein 1 (dog 180kD homolog), ribosome binding protein 1 homolog 180kDa (dog), Ribosome receptor protein, ribosome-binding protein 1, RRp

Gene Symbol

RRBP1

Additional RRBP1 Products

Product Documents for RRBP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RRBP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RRBP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RRBP1 Antibody - BSA Free and earn rewards!

Have you used RRBP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...