RUVBL1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-84913

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: GPPGTGKTALALAIAQELGSKVPFCPMVGSEVYSTEIKKTEVLMENFRRAIGLRIKETKEVYEGEVTELTPCETENPMGG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for RUVBL1 Antibody - BSA Free

Immunohistochemistry-Paraffin: RUVBL1 Antibody [NBP1-84913]

Immunohistochemistry-Paraffin: RUVBL1 Antibody [NBP1-84913]

Immunohistochemistry-Paraffin: RUVBL1 Antibody [NBP1-84913] - Staining of human fallopian tube using Anti-RUVBL1 antibody NBP1-84913.
Immunohistochemistry-Paraffin: RUVBL1 Antibody [NBP1-84913]

Immunohistochemistry-Paraffin: RUVBL1 Antibody [NBP1-84913]

Immunohistochemistry-Paraffin: RUVBL1 Antibody [NBP1-84913] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: RUVBL1 Antibody [NBP1-84913]

Immunohistochemistry-Paraffin: RUVBL1 Antibody [NBP1-84913]

Immunohistochemistry-Paraffin: RUVBL1 Antibody [NBP1-84913] - Staining of human fallopian tube shows high expression.
Immunohistochemistry-Paraffin: RUVBL1 Antibody [NBP1-84913]

Immunohistochemistry-Paraffin: RUVBL1 Antibody [NBP1-84913]

Immunohistochemistry-Paraffin: RUVBL1 Antibody [NBP1-84913] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: RUVBL1 Antibody [NBP1-84913]

Immunohistochemistry-Paraffin: RUVBL1 Antibody [NBP1-84913]

Immunohistochemistry-Paraffin: RUVBL1 Antibody [NBP1-84913] - Staining in human fallopian tube and skeletal muscle tissues using anti-RUVBL1 antibody. Corresponding RUVBL1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: RUVBL1 Antibody [NBP1-84913]

Immunohistochemistry-Paraffin: RUVBL1 Antibody [NBP1-84913]

Immunohistochemistry-Paraffin: RUVBL1 Antibody [NBP1-84913] - Staining of human fallopian tube, kidney, lymph node and testis using Anti-RUVBL1 antibody NBP1-84913 (A) shows similar protein distribution across tissues to independent antibody NBP1-84914 (B).
Immunohistochemistry-Paraffin: RUVBL1 Antibody [NBP1-84913]

Immunohistochemistry-Paraffin: RUVBL1 Antibody [NBP1-84913]

Immunohistochemistry-Paraffin: RUVBL1 Antibody [NBP1-84913] - Staining of human testis.
Immunohistochemistry-Paraffin: RUVBL1 Antibody [NBP1-84913]

Immunohistochemistry-Paraffin: RUVBL1 Antibody [NBP1-84913]

Immunohistochemistry-Paraffin: RUVBL1 Antibody [NBP1-84913] - Staining of human kidney.
Immunohistochemistry-Paraffin: RUVBL1 Antibody [NBP1-84913]

Immunohistochemistry-Paraffin: RUVBL1 Antibody [NBP1-84913]

Immunohistochemistry-Paraffin: RUVBL1 Antibody [NBP1-84913] - Staining of human lymph node.
RUVBL1 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: RUVBL1 Antibody - BSA Free [NBP1-84913]

Chromatin Immunoprecipitation-exo-Seq: RUVBL1 Antibody - BSA Free [NBP1-84913]

ChIP-Exo-Seq composite graph for Anti-RUVBL1 (NBP1-84913) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for RUVBL1 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RUVBL1

Possesses single-stranded DNA-stimulated ATPase and ATP-dependent DNA helicase (3' to 5') activity. Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. The NuA4 complex ATPase and helicase activities seem to be, at least in part, contributed by the association of RUVBL1 and RUVBL2 with EP400. NuA4 may also play a direct role in DNA repair when recruited to sites of DNA damage. RUVBL1 plays an essential role in oncogenic transformation by MYC and also modulates transcriptional activation by the LEF1/TCF1-CTNNB1 complex

Alternate Names

49 kDa TATA box-binding protein-interacting protein, 54 kDa erythrocyte cytosolic protein, EC 3.6.1, EC 3.6.4.12,49 kDa TBP-interacting protein, ECP54, INO80 complex subunit H, INO80HTIP49A, NMP 238, NMP238ECP-54, Nuclear matrix protein 238, PONTIN, Pontin 52, Pontin52, RuvB (E coli homolog)-like 1, ruvB-like 1, RuvB-like 1 (E. coli), RVB1, TATA binding protein interacting protein 49 kDa, TIH1, TIP49a, TIP49TAP54-alpha, TIP60-associated protein 54-alpha

Gene Symbol

RUVBL1

Additional RUVBL1 Products

Product Documents for RUVBL1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RUVBL1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RUVBL1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RUVBL1 Antibody - BSA Free and earn rewards!

Have you used RUVBL1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...