RXR alpha/NR2B1 Antibody (6Y10M1)
Novus Biologicals | Catalog # NBP3-15667
Recombinant Monoclonal Antibody
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation, Chromatin Immunoprecipitation (ChIP), Chromatin Immunoprecipitation Sequencing
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 6Y10M1 expressed in HEK293
Loading...
Product Specifications
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RXR alpha/NR2B1 (P19793). MDTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTPTLGFSTGSPQLSSPMNP
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
51 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for RXR alpha/NR2B1 Antibody (6Y10M1)
Western Blot: RXR alpha/NR2B1 Antibody (6Y10M1) [NBP3-15667]
Western Blot: RXR alpha/NR2B1 Antibody (6Y10M1) [NBP3-15667] - Western blot analysis of extracts of various cell lines, using RXR alpha/NR2B1 antibody (NBP3-15667) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 90s.Western Blot: RXR alpha/NR2B1 Antibody (6Y10M1) [NBP3-15667]
Western Blot: RXR alpha/NR2B1 Antibody (6Y10M1) [NBP3-15667] - Western blot analysis of extracts of various cell lines, using RXR alpha/NR2B1 antibody (NBP3-15667) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.Immunocytochemistry/ Immunofluorescence: RXR alpha/NR2B1 Antibody (6Y10M1) [RXR alpha/NR2B1] -
Immunocytochemistry/ Immunofluorescence: RXR alpha/NR2B1 Antibody (6Y10M1) [RXR alpha/NR2B1] - Confocal imaging of HeLa cells using RXR alpha/NR2B1 Rabbit mAb. The cells were counterstained with alpha-Tubulin Mouse mAb (Green). DAPI was used for nuclear staining (blue). Objective: 100x.Chromatin Immunoprecipitation: RXR alpha/NR2B1 Antibody (6Y10M1) [RXR alpha/NR2B1] -
Chromatin Immunoprecipitation: RXR alpha/NR2B1 Antibody (6Y10M1) [RXR alpha/NR2B1] - Chromatin immunoprecipitation was performed with 25 ug of cross-linked chromatin from HepG2 cells using 5 ug of RXR alpha/NR2B1 Rabbit mAb. DNA libraries were prepared using Scale ssDNA-seq Lib Prep Kit for Illumina V2. The ChIP sequencing results indicate the enrichment pattern of RXR alpha/NR2B1 across chromosome 19 (upper panel) and the genomic region encompassing ECH1, a representative gene enriched in RXR alpha/NR2B1 (lower panel).Chromatin Immunoprecipitation: RXR alpha/NR2B1 Antibody (6Y10M1) [RXR alpha/NR2B1] -
Chromatin Immunoprecipitation: RXR alpha/NR2B1 Antibody (6Y10M1) [RXR alpha/NR2B1] - Chromatin immunoprecipitation was performed with 25 ug of cross-linked chromatin from HepG2 cells using 5 ug of RXR alpha/NR2B1 Rabbit mAb. DNA libraries were prepared using Scale ssDNA-seq Lib Prep Kit for Illumina V2. The ChIP sequencing results indicate the enrichment pattern of RXR alpha/NR2B1 in the representative genomic region surrounding ECH1 gene.Chromatin Immunoprecipitation: RXR alpha/NR2B1 Antibody (6Y10M1) [RXR alpha/NR2B1] -
Chromatin Immunoprecipitation: RXR alpha/NR2B1 Antibody (6Y10M1) [RXR alpha/NR2B1] - Chromatin immunoprecipitation analysis of extracts from HepG2 cells, using RXR alpha/NR2B1 antibody and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.Applications for RXR alpha/NR2B1 Antibody (6Y10M1)
Application
Recommended Usage
Chromatin Immunoprecipitation (ChIP)
5μg antibody for 10μg-15μg of Chromatin
Chromatin Immunoprecipitation Sequencing
1:50 - 1:100
ELISA
Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Immunocytochemistry/ Immunofluorescence
1:100 - 1:1000
Immunoprecipitation
0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Western Blot
1:1000 - 1:2000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: RXR alpha/NR2B1
Long Name
Retinoid X Receptor, alpha
Alternate Names
NR2B1, RXRA
Gene Symbol
RXRA
Additional RXR alpha/NR2B1 Products
Product Documents for RXR alpha/NR2B1 Antibody (6Y10M1)
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for RXR alpha/NR2B1 Antibody (6Y10M1)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for RXR alpha/NR2B1 Antibody (6Y10M1)
There are currently no reviews for this product. Be the first to review RXR alpha/NR2B1 Antibody (6Y10M1) and earn rewards!
Have you used RXR alpha/NR2B1 Antibody (6Y10M1)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- ChIP Protocol Video
- Chromatin Immunoprecipitation (ChIP) Protocol
- Chromatin Immunoprecipitation Protocol
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunoprecipitation Protocol
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...