SAP130 Antibody (3K1X4)

Novus Biologicals | Catalog # NBP3-16842

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 3K1X4 expressed in HEK293
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1101-1217 of human SAP130 (Q15393). VLSLQKTTLIPGGSESLVYTTLSGGIGILVPFTSHEDHDFFQHVEMHLRSEHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSMEPNKQKNVSEELDRTPPEVSKKLEDIRTRYAF

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SAP130 Antibody (3K1X4)

Western Blot: SAP130 Antibody (3K1X4) [NBP3-16842]

Western Blot: SAP130 Antibody (3K1X4) [NBP3-16842]

Western Blot: SAP130 Antibody (3K1X4) [NBP3-16842] - Western blot analysis of extracts of various cell lines, using SAP130 Rabbit mAb (NBP3-16842) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Immunocytochemistry/ Immunofluorescence: SAP130 Antibody (3K1X4) [NBP3-16842]

Immunocytochemistry/ Immunofluorescence: SAP130 Antibody (3K1X4) [NBP3-16842]

Immunocytochemistry/Immunofluorescence: SAP130 Antibody (3K1X4) [NBP3-16842] - Immunofluorescence analysis of U-2 OS cells using SAP130 Rabbit mAb (NBP3-16842) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
SAP130 Antibody (3K1X4)

Immunohistochemistry: SAP130 Antibody (3K1X4) [NBP3-16842] -

Immunohistochemistry: SAP130 Antibody (3K1X4) [NBP3-16842] - Immunohistochemistry analysis of SAP130 in paraffin-embedded rat colon tissue using SAP130 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
SAP130 Antibody (3K1X4)

Immunohistochemistry: SAP130 Antibody (3K1X4) [NBP3-16842] -

Immunohistochemistry: SAP130 Antibody (3K1X4) [NBP3-16842] - Immunohistochemistry analysis of SAP130 in paraffin-embedded human colon carcinoma tissue using SAP130 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
SAP130 Antibody (3K1X4)

Immunohistochemistry: SAP130 Antibody (3K1X4) [NBP3-16842] -

Immunohistochemistry: SAP130 Antibody (3K1X4) [NBP3-16842] - Immunohistochemistry analysis of SAP130 in paraffin-embedded mouse lung tissue using SAP130 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
SAP130 Antibody (3K1X4)

Immunohistochemistry: SAP130 Antibody (3K1X4) [NBP3-16842] -

Immunohistochemistry: SAP130 Antibody (3K1X4) [NBP3-16842] - Immunohistochemistry analysis of SAP130 in paraffin-embedded Human lung adenocarcinoma tissue using SAP130 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
SAP130 Antibody (3K1X4)

Immunohistochemistry: SAP130 Antibody (3K1X4) [NBP3-16842] -

Immunohistochemistry: SAP130 Antibody (3K1X4) [NBP3-16842] - Immunohistochemistry analysis of SAP130 in paraffin-embedded mouse spleen tissue using SAP130 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
SAP130 Antibody (3K1X4)

Immunohistochemistry: SAP130 Antibody (3K1X4) [NBP3-16842] -

Immunohistochemistry: SAP130 Antibody (3K1X4) [NBP3-16842] - Immunohistochemistry analysis of SAP130 in paraffin-embedded rat spleen tissue using SAP130 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
SAP130 Antibody (3K1X4)

Immunohistochemistry: SAP130 Antibody (3K1X4) [NBP3-16842] -

Immunohistochemistry: SAP130 Antibody (3K1X4) [NBP3-16842] - Immunohistochemistry analysis of SAP130 in paraffin-embedded mouse brain tissue using SAP130 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
SAP130 Antibody (3K1X4)

Immunohistochemistry: SAP130 Antibody (3K1X4) [NBP3-16842] -

Immunohistochemistry: SAP130 Antibody (3K1X4) [NBP3-16842] - Immunohistochemistry analysis of SAP130 in paraffin-embedded mouse testis tissue using SAP130 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
SAP130 Antibody (3K1X4)

Immunohistochemistry: SAP130 Antibody (3K1X4) [NBP3-16842] -

Immunohistochemistry: SAP130 Antibody (3K1X4) [NBP3-16842] - Immunohistochemistry analysis of SAP130 in paraffin-embedded human thyroid cancer tissue using SAP130 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Applications for SAP130 Antibody (3K1X4)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: SAP130

SAP130 encodes subunit 3 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence independent manner and may anchor the U2 snRNP to the pre-mRNA. Splicing factor 3b is also a component of the minor U12-type spliceosome. Subunit 3 has also been identified as a component of the STAGA (SPT3-TAF(II)31-GCN5L acetylase) transcription coactivator-HAT (histone acetyltransferase) complex, and the TFTC (TATA-binding-protein-free TAF(II)-containing complex). These complexes may function in chromatin modification, transcription, splicing, and DNA repair.

Alternate Names

KIAA0017splicing factor 3b, subunit 3, 130kD, Pre-mRNA-splicing factor SF3b 130 kDa subunit, RSE1, SAP130SAP 130, SF3B130, SF3b130pre-mRNA splicing factor SF3b, 130 kDa subunit, Spliceosome-associated protein 130, splicing factor 3B subunit 3, splicing factor 3b, subunit 3, 130kDa, STAF130

Gene Symbol

SF3B3

Additional SAP130 Products

Product Documents for SAP130 Antibody (3K1X4)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SAP130 Antibody (3K1X4)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SAP130 Antibody (3K1X4)

There are currently no reviews for this product. Be the first to review SAP130 Antibody (3K1X4) and earn rewards!

Have you used SAP130 Antibody (3K1X4)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...