Recombinant SARS-CoV-2 Spike S1 His (C-Term) Protein
Novus Biologicals | Catalog # NBP2-90985
Key Product Details
Source
Tag
Applications
Product Specifications
Description
Source: HEK293
VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRAR (Accession #YP_009724390.1)
Purity
Endotoxin Level
Activity
Protein / Peptide Type
Scientific Data Images for Recombinant SARS-CoV-2 Spike S1 His (C-Term) Protein
ELISA: Recombinant SARS-CoV-2 Spike S1 His (C-Term) Protein [NBP2-90985]
ELISA: Recombinant SARS-CoV-2 Spike S1 His (C-Term) Protein [NBP2-90985] - Immobilized Recombinant SARS-COV-2 Spike S1 at 2ug/mL (100 uL/well) can bind Recombinant Human ACE2 with a linear range of 0.5-8.7 ng/mL.HPLC: Recombinant SARS-CoV-2 Spike S1 His (C-Term) Protein [NBP2-90985]
HPLC: Recombinant SARS-CoV-2 Spike S1 His (C-Term) Protein [NBP2-90985] - The purity of SARS-COV-2 Spike S1 Protein with His tag (Cat.NBP2-90985) was greater than 95% as determined by SEC-HPLC.SDS-PAGE: Recombinant SARS-CoV-2 Spike S1 His (C-Term) Protein [NBP2-90985]
SDS-Page: Recombinant SARS-CoV-2 Spike S1 His (C-Term) Protein [NBP2-90985] - Recombinant SARS-COV-2 Spike S1 Protein with His tag was determined by SDS-PAGE with Coomassie Blue, showing a band at 110-130 kDa.Surface Plasmon Resonance: Recombinant SARS-CoV-2 Spike S1 His (C-Term) Protein [NBP2-90985]
Surface Plasmon Resonance: Recombinant SARS-CoV-2 Spike S1 His (C-Term) Protein [NBP2-90985] - Immobilized Human ACE2 on COOH Chip, can bind SARS-COV-2 Spike S1 with an affinity constant of 11.4 nM as determined in a SPR assay.Formulation, Preparation, and Storage
NBP2-90985
| Formulation | Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4. |
| Preservative | No Preservative |
| Concentration | Lyoph |
| Reconstitution | Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. |
| Shipping | The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -20 to -70C. Avoid freeze-thaw cycles. |
Calculators
Background: SARS-CoV-2 Spike S1
Given the critical role of the spike protein RBD in the interaction with the ACE2 receptor and viral entry, a number of neutralizing antibodies against the RBD have been developed as potential therapeutics for treating COVID-19 (3). These antibodies bind the RBD domain on the S1 subunit inhibiting the interaction with ACE2 (3). However, more studies need to be done as neutralizing antibodies can result in antibody-dependent enhancement, in which the viral entry and replication within the host cell is increased (4). One potential way to combat antibody-dependent enhancement is the use of nanobodies (4). Furthermore, there are currently several vaccine strategies that are in clinical trials, or recently federally approved, that utilize the spike protein in different forms (e.g. full length, S1 RBD, RBD-Fc, N-terminal) for protecting against SARS-CoV-2 infection (4,5). These vaccine strategies include DNA vaccines, viral vector-based vaccines, RNA vaccines, and subunit vaccines (4,5).
References
1. Pillay T. S. (2020). Gene of the month: the 2019-nCoV/SARS-CoV-2 novel coronavirus spike protein. Journal of Clinical Pathology. https://doi.org/10.1136/jclinpath-2020-206658
2. Malik Y. A. (2020). Properties of Coronavirus and SARS-CoV-2. The Malaysian Journal of Pathology.
3. Ho M. (2020). Perspectives on the development of neutralizing antibodies against SARS-CoV-2. Antibody Therapeutics. https://doi.org/10.1093/abt/tbaa009
4. Samrat, S. K., Tharappel, A. M., Li, Z., & Li, H. (2020). Prospect of SARS-CoV-2 spike protein: Potential role in vaccine and therapeutic development. Virus Research. https://doi.org/10.1016/j.virusres.2020.198141
5. Sternberg, A., & Naujokat, C. (2020). Structural features of coronavirus SARS-CoV-2 spike protein: Targets for vaccination. Life Sciences. https://doi.org/10.1016/j.lfs.2020.118056
Alternate Names
Gene Symbol
Additional SARS-CoV-2 Spike S1 Products
Product Documents for Recombinant SARS-CoV-2 Spike S1 His (C-Term) Protein
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Recombinant SARS-CoV-2 Spike S1 His (C-Term) Protein
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.
Citations for Recombinant SARS-CoV-2 Spike S1 His (C-Term) Protein
Customer Reviews for Recombinant SARS-CoV-2 Spike S1 His (C-Term) Protein
There are currently no reviews for this product. Be the first to review Recombinant SARS-CoV-2 Spike S1 His (C-Term) Protein and earn rewards!
Have you used Recombinant SARS-CoV-2 Spike S1 His (C-Term) Protein?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- Troubleshooting Guide: ELISA
- View all Protocols, Troubleshooting, Illustrated assays and Webinars