SART3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35220

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 664-963 of human SART3 (NP_055521.1).

Sequence:
AGPAGKCAAVDVEPPSKQKEKAASLKRDMPKVLHDSSKDSITVFVSNLPYSMQEPDTKLRPLFEACGEVVQIRPIFSNRGDFRGYCYVEFKEEKSALQALEMDRKSVEGRPMFVSPCVDKSKNPDFKVFRYSTSLEKHKLFISGLPFSCTKEELEEICKAHGTVKDLRLVTNRAGKPKGLAYVEYENESQASQAVMKMDGMTIKENIIKVAISNPPQRKVPEKPETRKAPGGPMLLPQTYGARGKGRTQLSLLPRALQRPSAAAPQAENGPAAAPAVAAPAATEAPKMSNADFAKLFLRK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

110 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for SART3 Antibody - BSA Free

SART3 Antibody

Immunohistochemistry: SART3 Antibody [NBP3-35220] -

Immunohistochemistry: SART3 Antibody [NBP3-35220] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using SART3 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
SART3 Antibody

Immunohistochemistry: SART3 Antibody [NBP3-35220] -

Immunohistochemistry: SART3 Antibody [NBP3-35220] - Immunohistochemistry analysis of paraffin-embedded Human lymph node using SART3 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
SART3 Antibody

Immunohistochemistry: SART3 Antibody [NBP3-35220] -

Immunohistochemistry: SART3 Antibody [NBP3-35220] - Immunohistochemistry analysis of paraffin-embedded Mouse lung using SART3 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
SART3 Antibody

Western Blot: SART3 Antibody [NBP3-35220] -

Western Blot: SART3 Antibody [NBP3-35220] - Western blot analysis of various lysates using SART3 Rabbit pAb at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
SART3 Antibody

Immunohistochemistry: SART3 Antibody [NBP3-35220] -

Immunohistochemistry: SART3 Antibody [NBP3-35220] - Immunohistochemistry analysis of paraffin-embedded Rat brain using SART3 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Applications for SART3 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: SART3

SART3 is encoded by this gene is an RNA-binding nuclear protein that is a tumor-rejection antigen. This antigen possesses tumor epitopes capable of inducing HLA-A24-restricted and tumor-specific cytotoxic T lymphocytes in cancer patients and may be useful for specific immunotherapy. This gene product is found to be an important cellular factor for HIV-1 gene expression and viral replication. It also associates transiently with U6 and U4/U6 snRNPs during the recycling phase of the spliceosome cycle. This encoded protein is thought to be involved in the regulation of mRNA splicing.

Alternate Names

DSAP1, hSART-3, KIAA0156squamous cell carcinoma antigen recognised by T cells 3, P100, p110, p110(nrb), RP11-13G14, SART-3, squamous cell carcinoma antigen recognized by T cells 3, squamous cell carcinoma antigen recognized by T-cells 3, Tat-interacting protein of 110 kDa, Tip110, TIP110MGC138188

Gene Symbol

SART3

Additional SART3 Products

Product Documents for SART3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SART3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SART3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SART3 Antibody - BSA Free and earn rewards!

Have you used SART3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...