SAV1 Antibody (3B2) - Azide and BSA Free
Novus Biologicals | Catalog # H00060485-M02
Loading...
Key Product Details
Species Reactivity
Validated:
Human, Mouse, Yeast
Cited:
Human, Mouse
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation
Cited:
Immunohistochemistry-Paraffin, Western Blot
Label
Unconjugated
Antibody Source
Monoclonal Mouse IgG2a Kappa Clone # 3B2
Format
Azide and BSA Free
Loading...
Product Specifications
Immunogen
SAV1 (NP_068590, 300 a.a. ~ 383 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HTAEIPDWLQVYARAPVKYDHILKWELFQLADLDTYQGMLKLLFMKELEQIVKMYEAYRQALLTELENRKQRQQWYAQQHGKNF
Reactivity Notes
Mouse reactivity reported in scientific literature (PMID: 26913567).
Specificity
SAV1 - salvador homolog 1 (Drosophila)
Clonality
Monoclonal
Host
Mouse
Isotype
IgG2a Kappa
Scientific Data Images for SAV1 Antibody (3B2) - Azide and BSA Free
Western Blot: SAV1 Antibody (3B2) [H00060485-M02]
SAV1-Antibody-3B2-Western-Blot-H00060485-M02-img0012.jpgImmunocytochemistry/ Immunofluorescence: SAV1 Antibody (3B2) [H00060485-M02]
Immunocytochemistry/Immunofluorescence: SAV1 Antibody (3B2) [H00060485-M02] - Analysis of monoclonal antibody to SAV1 on HeLa cell. Antibody concentration 60 ug/ml.Western Blot: SAV1 Antibody (3B2) [H00060485-M02]
Western Blot: SAV1 Antibody (3B2) [H00060485-M02] - SAV1 monoclonal antibody (M02), clone 3B2. Analysis of SAV1 expression in HepG2.Immunoprecipitation: SAV1 Antibody (3B2) [H00060485-M02]
Immunoprecipitation: SAV1 Antibody (3B2) [H00060485-M02] - Analysis of SAV1 transfected lysate using anti-SAV1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SAV1 MaxPab rabbit polyclonal antibody.ELISA: SAV1 Antibody (3B2) [H00060485-M02]
ELISA: SAV1 Antibody (3B2) [H00060485-M02] - Detection limit for recombinant GST tagged SAV1 is approximately 0.1ng/ml as a capture antibody.Western Blot: SAV1 Antibody (3B2) [H00060485-M02] -
Western Blot: SAV1 Antibody (3B2) [H00060485-M02] - MST2 & SAV1 increase the levels of PPAR gamma by increasing its protein stability.(A) Increasing amounts (0.5, 1, 3 µg) of Myc-SAV1 were co-expressed with Flag-PPAR gamma and/or HA-MST2 in 293 cells. At 48 h after transfection, cell lysates were immunoblotted with the indicated antibodies. (B) Flag-tagged PPAR gamma or PPAR gamma (128–505) was co-expressed with HA-MST2, HA-MST2-KD (inactive mutant), Myc-SAV1, and/or Myc-SAV1(1–201) in 293 cells as indicated. Cell lysates were prepared at various times after treatment with 40 µg/mL cycloheximide & then immunoblotted with an anti-Flag antibody. The PPAR gamma protein expression was quantified & the half-life of PPAR gamma protein was calculated. Expression of GAPDH was detected as a loading control. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/22292086), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for SAV1 Antibody (3B2) - Azide and BSA Free
Application
Recommended Usage
ELISA
1:100-1:2000
Immunocytochemistry/ Immunofluorescence
1:10-1:2000
Immunoprecipitation
1:10-1:500
Western Blot
1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA. Use in Immunohistochemistry-paraffin reported in scientific literature (PMID: 26913567).
Formulation, Preparation, and Storage
Purification
IgG purified
Formulation
In 1x PBS, pH 7.4
Format
Azide and BSA Free
Preservative
No Preservative
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Background: SAV1
Alternate Names
45 kDa WW domain protein, hWW45, protein salvador homolog 1, salvador homolog 1 (Drosophila), SAV, WW domain-containing, WW45salvador, WWP4,1700040G09Rik
Entrez Gene IDs
60485 (Human)
Gene Symbol
SAV1
OMIM
607203 (Human)
UniProt
Additional SAV1 Products
Product Documents for SAV1 Antibody (3B2) - Azide and BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for SAV1 Antibody (3B2) - Azide and BSA Free
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for SAV1 Antibody (3B2) - Azide and BSA Free
Customer Reviews for SAV1 Antibody (3B2) - Azide and BSA Free
There are currently no reviews for this product. Be the first to review SAV1 Antibody (3B2) - Azide and BSA Free and earn rewards!
Have you used SAV1 Antibody (3B2) - Azide and BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Immunoprecipitation Protocol
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...