SCML1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55711

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SNSSSEIDVQEPNIVSDASCNTEEQLKTVDDVLIHCQVIYDALQNLDKKIDVIRRKVSKIQRFHVRSL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SCML1 Antibody - BSA Free

Western Blot: SCML1 Antibody [NBP2-55711]

Western Blot: SCML1 Antibody [NBP2-55711]

Western Blot: SCML1 Antibody [NBP2-55711] - Western blot analysis in human cell line RT-4, human cell line U-251 MG and human plasma.
Immunocytochemistry/ Immunofluorescence: SCML1 Antibody [NBP2-55711]

Immunocytochemistry/ Immunofluorescence: SCML1 Antibody [NBP2-55711]

Immunocytochemistry/Immunofluorescence: SCML1 Antibody [NBP2-55711] - Staining of human cell line PC-3 shows localization to nucleoplasm.
SCML1 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: SCML1 Antibody - BSA Free [NBP2-55711]

Chromatin Immunoprecipitation-exo-Seq: SCML1 Antibody - BSA Free [NBP2-55711]

ChIP-Exo-Seq composite graph for Anti-SCML1 (NBP2-55711) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for SCML1 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SCML1

Putative Polycomb group (PcG) protein. PcG proteins act by forming multiprotein complexes, which are required to maintain the transcriptionally repressive state of homeotic genes throughout development. May be involved in spermatogenesis during sexual maturation

Alternate Names

sex comb on midleg (Drosophila)-like 1, sex comb on midleg-like 1 (Drosophila), sex comb on midleg-like protein 1

Gene Symbol

SCML1

Additional SCML1 Products

Product Documents for SCML1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SCML1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SCML1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SCML1 Antibody - BSA Free and earn rewards!

Have you used SCML1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...