SCYL1BP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-92371

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: FSSPTLPSHFTLTSPVGDGQPQGIESQPKELGLENSHDGHNNVEILPPKPDCKLEKKKVELQEKSRWEVLQQEQRLME

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SCYL1BP1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: SCYL1BP1 Antibody [NBP1-92371]

Immunocytochemistry/ Immunofluorescence: SCYL1BP1 Antibody [NBP1-92371]

Immunocytochemistry/Immunofluorescence: SCYL1BP1 Antibody [NBP1-92371] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm, cytosol & the Golgi apparatus. Antibody staining is shown in green.
SCYL1BP1 Antibody - BSA Free Immunohistochemistry: SCYL1BP1 Antibody - BSA Free [NBP1-92371]

Immunohistochemistry: SCYL1BP1 Antibody - BSA Free [NBP1-92371]

Staining of human colon shows moderate cytoplasmic positivity in glandular cells.
SCYL1BP1 Antibody - BSA Free Immunohistochemistry: SCYL1BP1 Antibody - BSA Free [NBP1-92371]

Immunohistochemistry: SCYL1BP1 Antibody - BSA Free [NBP1-92371]

Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
SCYL1BP1 Antibody - BSA Free Immunohistochemistry: SCYL1BP1 Antibody - BSA Free [NBP1-92371]

Immunohistochemistry: SCYL1BP1 Antibody - BSA Free [NBP1-92371]

Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.
SCYL1BP1 Antibody - BSA Free Immunohistochemistry: SCYL1BP1 Antibody - BSA Free [NBP1-92371]

Immunohistochemistry: SCYL1BP1 Antibody - BSA Free [NBP1-92371]

Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Applications for SCYL1BP1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SCYL1BP1

NTKL-binding protein 1 (GORAB) belongs to the golgin family of coiled-coil proteins located in the golgi apparatus. GORAB interacts with SCYL1, RCHY1 and RAB6A/RAB6. At least 4 isoforms are produced by alternative splicing.

Alternate Names

FLJ11752, golgin, RAB6-interacting, GONTKL-binding protein 1, hNTKL-BP1, MGC51263, MGC70512, N-terminal kinase-like-binding protein 1, NTKL-BP1, NTKLBP1SCY1-like 1-binding protein 1, RAB6-interacting golgin, SCY1-like 1 binding protein 1, SCYL1-BP1, SCYL1BP1SCYL1-binding protein 1

Gene Symbol

GORAB

Additional SCYL1BP1 Products

Product Documents for SCYL1BP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SCYL1BP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SCYL1BP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SCYL1BP1 Antibody - BSA Free and earn rewards!

Have you used SCYL1BP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...