Semaphorin 3F Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-91480

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunoprecipitation

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptide directed towards the N terminal of human Sema3f. Peptide sequence FIHAELIPDSAERNDDKLYFFFRERSAEAPQNPAVYARIGRICLNDDGGH. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Semaphorin 3F Antibody - BSA Free

Western Blot: Semaphorin 3F Antibody [NBP1-91480]

Western Blot: Semaphorin 3F Antibody [NBP1-91480]

Western Blot: Semaphorin 3F Antibody [NBP1-91480] - Positive control: Lane1 : No transfection, Lane, 2: Cell lysates from HEK293 cells were transfected with alkaline phosphatase (AP-) tagged Sema3F, Lane3: AP-alone, Lane4: The cell media from cells transfected with AP-Sema3F Primary, Antibody Dilution: 1 ug/ml Secondary Antibody: Anti-AP Secondry, Antibody Dilution: 1 : 1000.
Immunohistochemistry: Semaphorin 3F Antibody [NBP1-91480]

Immunohistochemistry: Semaphorin 3F Antibody [NBP1-91480]

Immunohistochemistry: Semaphorin 3F Antibody [NBP1-91480] - Researcher: Dr. Chrisna LeVaillant, School of Anatomy and Human BiologyApplication: IPSpecies+tissue/cell type: 1. 5mL conditioned media from HEK293F cells transfected with 1 : Sema 3F_AP, 2: Sema3C_FLAG, 3: UntransfectedAmount of IP.
Western Blot: Semaphorin 3F Antibody [NBP1-91480]

Western Blot: Semaphorin 3F Antibody [NBP1-91480]

Western Blot: Semaphorin 3F Antibody [NBP1-91480] - Titration: 1.0 ug/ml Positive Control: Mouse Liver.
Immunohistochemistry: Semaphorin 3F Antibody [NBP1-91480]

Immunohistochemistry: Semaphorin 3F Antibody [NBP1-91480]

Immunohistochemistry: Semaphorin 3F Antibody [NBP1-91480] - Untransfected HEK293 and Sema3F-AP transfected HEK293 Primary Antibody Dilution: 1 : 1000 Secondary Antibody: Anti rabbit-Alexa Fluor 488 Secondary Antibody Dilution: 1 : 500 Color/Signal Descriptions: Gene name: SEMA3F.

Applications for Semaphorin 3F Antibody - BSA Free

Application
Recommended Usage

Immunoprecipitation

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Semaphorin 3F

The Semaphorins make up the largest family of axon guidance cues yet described. Semaphorins are divided into 8 classes (classes 3-7 found in vertebrates). Class 3 Semaphorins are secreted, classes 4 through 6 are transmembrane proteins, and class 7 are membrane associated via glycosylphosphatidylinositol (GPI) linkage. They are characterized structurally by a conserved ~400 amino acid sema domain. They are classically described as collapsing factors and mediators of axon repulsion, although they may also act as context-dependent chemoattractants. Semaphorins have been shown to have roles in cardiovascular development and in the regulation of immune cell antigen presentation. Receptors or receptor complexes that mediate semaphorin signaling include proteins of the Neuropilin and Plexin families.

Alternate Names

Sema3F, SEMA4, SEMAK

Gene Symbol

SEMA3F

Additional Semaphorin 3F Products

Product Documents for Semaphorin 3F Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Semaphorin 3F Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Semaphorin 3F Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Semaphorin 3F Antibody - BSA Free and earn rewards!

Have you used Semaphorin 3F Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...