Septin-7 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-85730

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MSVSARSAAAEERSVNSSTMVAQQKNLEGYVGFANLPNQVYRKSVKRGFEFTLMVVGESG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

51 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Septin-7 Antibody - BSA Free

Immunohistochemistry-Paraffin: Septin-7 Antibody [NBP1-85730]

Immunohistochemistry-Paraffin: Septin-7 Antibody [NBP1-85730]

Immunohistochemistry-Paraffin: Septin-7 Antibody [NBP1-85730] - Staining in human cerebral cortex and skeletal muscle tissues. Corresponding SEPT7 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Septin-7 Antibody [NBP1-85730]

Immunohistochemistry-Paraffin: Septin-7 Antibody [NBP1-85730]

Immunohistochemistry-Paraffin: Septin-7 Antibody [NBP1-85730] - Staining of human cerebral cortex, lymph node, skeletal muscle and testis using Anti-SEPT7 antibody NBP1-85730 (A) shows similar protein distribution across tissues to independent antibody NBP1-85731 (B).
Immunocytochemistry/ Immunofluorescence: Septin-7 Antibody [NBP1-85730]

Immunocytochemistry/ Immunofluorescence: Septin-7 Antibody [NBP1-85730]

Immunocytochemistry/Immunofluorescence: Septin-7 Antibody [NBP1-85730] - Staining of human cell line U-2 OS shows localization to actin filaments & midbody. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Septin-7 Antibody [NBP1-85730]

Immunohistochemistry-Paraffin: Septin-7 Antibody [NBP1-85730]

Immunohistochemistry-Paraffin: Septin-7 Antibody [NBP1-85730] - Staining of human cerebral cortex shows positivity in neuropil.
Immunohistochemistry-Paraffin: Septin-7 Antibody [NBP1-85730]

Immunohistochemistry-Paraffin: Septin-7 Antibody [NBP1-85730]

Immunohistochemistry-Paraffin: Septin-7 Antibody [NBP1-85730] - Staining of human lymph node shows moderate cytoplasmic positivity in lymphoid cells.
Immunohistochemistry-Paraffin: Septin-7 Antibody [NBP1-85730]

Immunohistochemistry-Paraffin: Septin-7 Antibody [NBP1-85730]

Immunohistochemistry-Paraffin: Septin-7 Antibody [NBP1-85730] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: Septin-7 Antibody [NBP1-85730]

Immunohistochemistry-Paraffin: Septin-7 Antibody [NBP1-85730]

Immunohistochemistry-Paraffin: Septin-7 Antibody [NBP1-85730] - Staining of human testis shows positivity in cells in seminiferous ducts.
Septin-7 Antibody - BSA Free Western Blot: Septin-7 Antibody - BSA Free [NBP1-85730]

Western Blot: Septin-7 Antibody - BSA Free [NBP1-85730]

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Septin-7 Antibody - BSA Free Western Blot: Septin-7 Antibody - BSA Free [NBP1-85730]

Western Blot: Septin-7 Antibody - BSA Free [NBP1-85730]

Analysis in human cell line NTERA-2.

Applications for Septin-7 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Septin-7

This gene encodes a protein that is highly similar to the CDC10 protein of Saccharomyces cerevisiae. The protein also shares similarity with Diff 6 of Drosophila and with H5 of mouse. Each of these similar proteins, including the yeast CDC10, contains a GTP-binding motif. The yeast CDC10 protein is a structural component of the 10 nm filament which lies inside the cytoplasmic membrane and is essential for cytokinesis. Although the exact function of this gene has not yet been determined, its high similarity to yeast CDC10 and the high conservative nature of eukaryotic cell cycle machinery suggest a similar role to that of its yeast counterpart. Alternative splicing results in two transcript variants encoding different isoforms. [provided by RefSeq]

Alternate Names

CDC10 cell division cycle 10 homolog, CDC10 cell division cycle 10 homolog (S. cerevisiae), CDC10 protein homolog, CDC10S. cerevisiae, homolog), Nbla02942, septin 7, septin-7

Entrez Gene IDs

989 (Human)

Gene Symbol

SEPTIN7

UniProt

Additional Septin-7 Products

Product Documents for Septin-7 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Septin-7 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Septin-7 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Septin-7 Antibody - BSA Free and earn rewards!

Have you used Septin-7 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...