SFPQ Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57458

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to SFPQ (splicing factor proline/glutamine-rich (polypyrimidine tract binding protein associated)) The peptide sequence was selected from the N terminal of SFPQ. Peptide sequence VPGPGPGPKQGPGPGGPKGGKMPGGPKPGGGPGLSTPGGHPKPPHRGGGE The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for SFPQ Antibody - BSA Free

Western Blot: SFPQ Antibody [NBP1-57458]

Western Blot: SFPQ Antibody [NBP1-57458]

Western Blot: SFPQ Antibody [NBP1-57458] - Lanes: Lane 1 : 50ug Hela lysate Primary, Antibody Dilution: 1 : 1000 Secondary Antibody: Anti-rabbit-HRP Secondary, Antibody Dilution: 1 : 10,000 Gene name: SFPQ.
Immunohistochemistry: SFPQ Antibody [NBP1-57458]

Immunohistochemistry: SFPQ Antibody [NBP1-57458]

Immunohistochemistry: SFPQ Antibody [NBP1-57458] - Human Heart cell Cellular data: cardiac cell of renal tubule Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.
Western Blot: SFPQ Antibody [NBP1-57458]

Western Blot: SFPQ Antibody [NBP1-57458]

Western Blot: SFPQ Antibody [NBP1-57458] - HepG2 cell lysate, Antibody Titration: 1.25ug/ml
Immunohistochemistry-Paraffin: SFPQ Antibody [NBP1-57458]

Immunohistochemistry-Paraffin: SFPQ Antibody [NBP1-57458]

Immunohistochemistry-Paraffin: SFPQ Antibody [NBP1-57458] - Human Intestine Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Epithelial cells of intestinal villus (indicated with arrows) 400X magnification.
Immunohistochemistry-Paraffin: SFPQ Antibody [NBP1-57458]

Immunohistochemistry-Paraffin: SFPQ Antibody [NBP1-57458]

Immunohistochemistry-Paraffin: SFPQ Antibody [NBP1-57458] - Human Skin Tissue Squamous epithelial cells (Indicated with Arrows), 4-8ug/ml.

Applications for SFPQ Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SFPQ

SFPQ is DNA- and RNA binding protein. It is essential pre-mRNA splicing factor required early in spliceosome formation and for splicing catalytic step II, probably as an heteromer with NONO. It binds to pre-mRNA in spliceosome C complex, and specifically binds to intronic polypyrimidine tracts. It interacts with U5 snRNA. It may be involved in a pre-mRNA coupled splicing and polyadenylation process as component of a snRNP-free complex with SNRPA/U1A. SFPQ may be involved in homologous DNA pairing. SFPQ is involved in transcriptional regulation. It binds the DNA sequence 5'-CTGAGTC-3' in the insulin-like growth factor response element (IGFRE) and inhibits IGF-I-stimulated transcriptional activity.

Alternate Names

100 kDa DNA-pairing protein, DNA-binding p52/p100 complex, 100 kDa subunit, hPOMp100, polypyrimidine tract binding protein associated, polypyrimidine tract-binding protein-associated splicing factor, Polypyrimidine tract-binding protein-associated-splicing factor, PSFPOMP100, PTB-associated splicing factor, PTB-associated-splicing factor, splicing factor proline/glutamine rich (polypyrimidine tract binding proteinassociated), splicing factor proline/glutamine rich (polypyrimidine tract-bindingprotein-associated), splicing factor proline/glutamine-rich, splicing factor, proline- and glutamine-rich

Gene Symbol

SFPQ

UniProt

Additional SFPQ Products

Product Documents for SFPQ Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SFPQ Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SFPQ Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SFPQ Antibody - BSA Free and earn rewards!

Have you used SFPQ Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...