SG2NA Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88256

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all SG2NA Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human SG2NA. Peptide sequence: HKIGNEGLAADLTDDPDTEEALKEFDFLVTAEDGEGAGEARSSGDGTEWV The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for SG2NA Antibody - BSA Free

Western Blot: SG2NA Antibody [NBP2-88256]

Western Blot: SG2NA Antibody [NBP2-88256]

Western Blot: SG2NA Antibody [NBP2-88256] - Host: Rabbit. Target Name: STRN3. Sample Tissue: Human ACHN Whole Cell. Antibody Dilution: 1ug/ml

Applications for SG2NA Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SG2NA

SG2NA was identified as a human cancer autoantigen and has now been implicated in vesicular trafficking and signal transduction. It is highly related to striatin and zinedin. It is a scaffolding protein that binds PP2A A and C subunits as well as the human homolog of the yeast protein, Mob1, which has been implicated in control of mitotic progression in yeast. It also binds calmodulin and appears to modulate PP2A activity.

Alternate Names

Cell cycle autoantigen SG2NA, cell cycle S/G2 nuclear autoantigen, GS2NA, S/G2 antigen, SG2NAnuclear autoantigen, striatin, calmodulin binding protein 3, striatin-3

Gene Symbol

STRN3

Additional SG2NA Products

Product Documents for SG2NA Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SG2NA Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SG2NA Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SG2NA Antibody - BSA Free and earn rewards!

Have you used SG2NA Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies