SH3BP5L Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-81381
Loading...
Key Product Details
Species Reactivity
Validated:
Human
Predicted:
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: CQQAEARVQALQKTLRRAIGKSRPYFELKAQFSQILEEHKAKVTELEQQVAQAKTRYSVALRNLEQISEQIHARRRGGLPPHPLGPRRSSPVGAEAGPED
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for SH3BP5L Antibody - BSA Free
Western Blot: SH3BP5L Antibody [NBP1-81381]
Western Blot: SH3BP5L Antibody [NBP1-81381] - Analysis in control (vector only transfected HEK293T lysate) and SH3BP5L over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).Immunocytochemistry/ Immunofluorescence: SH3BP5L Antibody [NBP1-81381]
Immunocytochemistry/Immunofluorescence: SH3BP5L Antibody [NBP1-81381] - Staining of human cell line A-431 shows localization to nucleoplasm, the Golgi apparatus & vesicles. Antibody staining is shown in green.Immunohistochemistry-Paraffin: SH3BP5L Antibody [NBP1-81381]
Immunohistochemistry-Paraffin: SH3BP5L Antibody [NBP1-81381] - Staining of human duodenum shows strong membranous positivity in glandular cells.Western Blot: SH3BP5L Antibody - BSA Free [NBP1-81381] -
Expression of key genes at mRNA and protein levels in the hippocampus of TLE animal model. (A) Construction of the TLE mouse model. It primarily illustrates the process of animal anesthesia and fixation, kainic acid injection localization, brain tissue separation on ice, and hippocampus extraction. (B) Expression levels of core genes' corresponding mRNA in the hippocampus of NC and TLE groups identified by qPCR. Data are shown as mean +/- SE. (C) Western blot analysis of hippocampal lysates displaying the protein levels of Dnmt1, Cdc25b, Ssh2, Fgd3, Gzma, Raf1, and Mx1 with Actin serving as a loading control. Approximate molecular weights are indicated. (D) Quantification of Western blot analysis of the protein bands in Figure C, through relative gray values compared across NC and TLE hippocampus samples. (E) Quantitative analyses of immunofluorescence staining showing the fluorescence intensity between NC and TLE in Figure F. (F) Representative immunofluorescence images showing the hippocampal localization of Cdc25b, Raf1, Fgd3, Dnmt1, Mx1, and Ssh2 (red) with DAPI staining the nuclei (blue) in NC and TLE groups (Scale bar, 100 μm). (TLE, temporal lobe epilepsy; NC, normal control. *p < 0.05, **p < 0.01, ***p < 0.001, ns, not significant.) Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/39753851), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for SH3BP5L Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:50 - 1:200
Immunohistochemistry-Paraffin
1:50 - 1:200
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: SH3BP5L
Alternate Names
FLJ33845, KIAA1720SH3BP-5-like, SH3 domain-binding protein 5-like, SH3-binding domain protein 5-like
Gene Symbol
SH3BP5L
Additional SH3BP5L Products
Product Documents for SH3BP5L Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for SH3BP5L Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for SH3BP5L Antibody - BSA Free
Customer Reviews for SH3BP5L Antibody - BSA Free
There are currently no reviews for this product. Be the first to review SH3BP5L Antibody - BSA Free and earn rewards!
Have you used SH3BP5L Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...