SLC22A7 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-62660

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SLC22A7 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to SLC22A7(solute carrier family 22 (organic anion transporter), member 7) The peptide sequence was selected from the N terminal of SLC22A7. Peptide sequence LPGAPANFSHQDVWLEAHLPREPDGTLSSCLRFAYPQALPNTTLGEERQS The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

60 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for SLC22A7 Antibody - BSA Free

Western Blot: SLC22A7 Antibody [NBP1-62660]

Western Blot: SLC22A7 Antibody [NBP1-62660]

Western Blot: SLC22A7 Antibody [NBP1-62660] - Sample Tissue: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.5ug/mL, Peptide Concentration: 2.0ug/mL, Lysate Quantity: 25ug/lane, Gel Concentration: 12%
Immunohistochemistry-Paraffin: SLC22A7 Antibody [NBP1-62660]

Immunohistochemistry-Paraffin: SLC22A7 Antibody [NBP1-62660]

Immunohistochemistry-Paraffin: SLC22A7 Antibody [NBP1-62660] - Human Muscle Tissue, Skeletal muscle cells (Indicated with Arrows) 4-8ug/ml.
Western Blot: SLC22A7 Antibody [NBP1-62660]

Western Blot: SLC22A7 Antibody [NBP1-62660]

Western Blot: SLC22A7 Antibody [NBP1-62660] - Titration: 5.0ug/ml Positive Control: Jurkat cell lysate.

Applications for SLC22A7 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SLC22A7

SLC22A7 is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney.The protein encoded by this gene is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney. Alternatively spliced transcript variants encoding different isoforms have been described.

Alternate Names

hOAT2, liver-specific transporter, NLTMGC45202, Novel liver transporter, OAT2MGC24091, Organic anion transporter 2, solute carrier family 22 (organic anion transporter), member 7, solute carrier family 22 member 7

Gene Symbol

SLC22A7

UniProt

Q5T048 (Human)

Additional SLC22A7 Products

Product Documents for SLC22A7 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SLC22A7 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SLC22A7 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SLC22A7 Antibody - BSA Free and earn rewards!

Have you used SLC22A7 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies