SLC25A24 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35221

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human SLC25A24 (NP_037518.3).

Sequence:
MLRWLRDFVLPTAACQDAEQPTRYETLFQALDRNGDGVVDIGELQEGLRNLGIPLGQDAEEKIFTTGDVNKDGKLDFEEFMKYLKDHEKKMKLAFKSLDKNNDGKIEASEIVQSLQTLGLTISEQQAELILQSIDVDGTMTVDWNEWRDYFLFNPVTDIEEIIRFWKHSTGIDIGDSLTIPDEFTEDEKKSGQWWRQLLA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

53 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for SLC25A24 Antibody - BSA Free

SLC25A24 Antibody

Immunocytochemistry/ Immunofluorescence: SLC25A24 Antibody [NBP3-35221] -

Immunocytochemistry/ Immunofluorescence: SLC25A24 Antibody [NBP3-35221] - Immunofluorescence analysis of HeLa cells using SLC25A24 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
SLC25A24 Antibody

Immunocytochemistry/ Immunofluorescence: SLC25A24 Antibody [NBP3-35221] -

Immunocytochemistry/ Immunofluorescence: SLC25A24 Antibody [NBP3-35221] - Immunofluorescence analysis of C6 cells using SLC25A24 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
SLC25A24 Antibody

Immunocytochemistry/ Immunofluorescence: SLC25A24 Antibody [NBP3-35221] -

Immunocytochemistry/ Immunofluorescence: SLC25A24 Antibody [NBP3-35221] - Immunofluorescence analysis of NIH/3T3 cells using SLC25A24 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
SLC25A24 Antibody

Western Blot: SLC25A24 Antibody [NBP3-35221] -

Western Blot: SLC25A24 Antibody [NBP3-35221] - Western blot analysis of various lysates using SLC25A24 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 1s.

Applications for SLC25A24 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: SLC25A24

Calcium-dependent mitochondrial solute carrier. Mitochondrial solute carriers shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane. May act as a ATP-Mg/Pi exchanger that mediates the transport of Mg-ATP in exchange for phosphate, catalyzing the net uptake or efflux of adenine nucleotides into or from the mitochondria

Alternate Names

APC1calcium-binding mitochondrial carrier protein SCaMC-1, calcium-binding transporter, DKFZp586G0123, MCSC1, Mitochondrial ATP-Mg/Pi carrier protein 1, mitochondrial ATP-Mg/Pi transporter, Mitochondrial Ca(2+)-dependent solute carrier protein 1, SCAMC1, SCAMC-1, short calcium-binding mitochondrial carrier 1, Small calcium-binding mitochondrial carrier protein 1, solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 24, Solute carrier family 25 member 24

Gene Symbol

SLC25A24

Additional SLC25A24 Products

Product Documents for SLC25A24 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SLC25A24 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SLC25A24 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SLC25A24 Antibody - BSA Free and earn rewards!

Have you used SLC25A24 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...