SLC2A13 Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-94351
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 564-648 of human SLC2A13 (NP_443117.3). LHTAEYLTYYGAFFLYAGFAAVGLLFIYGCLPETKGKKLEEIESLFDNRLCTCGTSDSDEGRYIEYIRVKGSNYHLSDNDASDVE
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
70 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for SLC2A13 Antibody - BSA Free
Western Blot: SLC2A13 AntibodyBSA Free [NBP2-94351]
Western Blot: SLC2A13 Antibody [NBP2-94351] - Analysis of extracts of various cell lines, using SLC2A13 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.Applications for SLC2A13 Antibody - BSA Free
Application
Recommended Usage
Western Blot
1:1000 - 1:4000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: SLC2A13
Alternate Names
H(+)-myo-inositol cotransporter, H(+)-myo-inositol symporter, Hmit, HMITproton (H+) myo-inositol symporter, MGC48624, proton myo-inositol cotransporter, solute carrier family 2 (facilitated glucose transporter), member 13
Gene Symbol
SLC2A13
Additional SLC2A13 Products
Product Documents for SLC2A13 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for SLC2A13 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for SLC2A13 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review SLC2A13 Antibody - BSA Free and earn rewards!
Have you used SLC2A13 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...