SLC6A16 Antibody (2E5) - Azide and BSA Free

Novus Biologicals | Catalog # H00028968-M13

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Sandwich ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # 2E5

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

SLC6A16 (NP_054756.2, 406 a.a. ~ 492 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RCCERNAEILLKLINLGKLPPDAKPPVNLLYNPTSIYNAWLSGLPQHIKSMVLREVTECNIETQFLKASEGPKFAFLSFVEAMSFLP

Specificity

SLC6A16 - solute carrier family 6, member 16 (2E5)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Scientific Data Images for SLC6A16 Antibody (2E5) - Azide and BSA Free

Western Blot: SLC6A16 Antibody (2E5) [H00028968-M13]

Western Blot: SLC6A16 Antibody (2E5) [H00028968-M13]

Western Blot: SLC6A16 Antibody (2E5) [H00028968-M13] - Analysis of SLC6A16 expression in transfected 293T cell line by SLC6A16 monoclonal antibody (M13), clone 2E5. Lane 1: SLC6A16 transfected lysate (Predicted MW: 73.5 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/ Immunofluorescence: SLC6A16 Antibody (2E5) [H00028968-M13]

Immunocytochemistry/ Immunofluorescence: SLC6A16 Antibody (2E5) [H00028968-M13]

Immunocytochemistry/Immunofluorescence: SLC6A16 Antibody (2E5) [H00028968-M13] - Analysis of monoclonal antibody to SLC6A16 on HeLa cell. Antibody concentration 10 ug/ml
Sandwich ELISA: SLC6A16 Antibody (2E5) [H00028968-M13] - Detection limit for recombinant GST tagged SLC6A16 is 1 ng/ml as a capture antibody.

Applications for SLC6A16 Antibody (2E5) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: SLC6A16

SLC6A16 shows structural characteristics of an Na(+)- and Cl(-)-dependent neurotransmitter transporter, including 12 transmembrane (TM) domains, intracellular N and C termini, and large extracellular loops containing multiple N-glycosylation sites.[supplied by OMIM]

Alternate Names

NTT5solute carrier family 6 (neurotransmitter transporter), member 16, orphan sodium- and chloride-dependent neurotransmitter transporter NTT5, Solute carrier family 6 member 16, solute carrier family 6, member 16

Entrez Gene IDs

28968 (Human)

Gene Symbol

SLC6A16

Additional SLC6A16 Products

Product Documents for SLC6A16 Antibody (2E5) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SLC6A16 Antibody (2E5) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SLC6A16 Antibody (2E5) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review SLC6A16 Antibody (2E5) - Azide and BSA Free and earn rewards!

Have you used SLC6A16 Antibody (2E5) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...