SLC6A2/NET/Noradrenaline transporter Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85762

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SLC6A2/NET/Noradrenaline transporter. Peptide sequence: FTPAAEFYERGVLHLHESSGIHDIGLPQWQLLLCLMVVVIVLYFSLWKGV The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for SLC6A2/NET/Noradrenaline transporter Antibody - BSA Free

Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP2-85762]

Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP2-85762]

Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP2-85762] - Researcher: Lesie Sheiton, Physiological Sciences GIDP, University of Arizona. Application: Western blotting. Species + Tissue/Cell type: 1: 50ug human placenta lysate, 2: 50ug human placenta lysate, 3: 50ug sheep placenta lysate, 4: 50ug sheep placenta lysate. Primary antibody dilution: 1:1000. Secondary antibody: Anti-rabbit HRP. Secondary antibody dilution: 1:20,000
Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP2-85762]

Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP2-85762]

Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP2-85762] - WB Suggested Anti-SLC6A2 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: HepG2 cell lysate
Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP2-85762]

Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP2-85762]

Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP2-85762] - Host: Rabbit. Target Name: SLC6A2. Sample Tissue: Rat Brain. Antibody Dilution: 1ug/ml
Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP2-85762]

Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP2-85762]

Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP2-85762] - Host: Rat. Target Name: SLC6A2. Sample Tissue: Rat Brain. Antibody Dilution: 1ug/ml

Applications for SLC6A2/NET/Noradrenaline transporter Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SLC6A2/NET

Norepinephrine Transporter [NET] (or noradrenaline transporter (NAT)) is a monoamine transporter that transports the neurotransmitter noradrenaline from the synapse back to its vesicles for storage until later use. It also appears to transport the neurotransmitter dopamine in the same way, but to a lesser degree. Studies have shown a decrease in NET levels in the locus coeruleus in patients diagnosed with major depression (Klimek et al., 1997). Cocaine, amphetamines and many therapeutic antidepressants, such as the SNRIs (Serotonin-norepinephrine reuptake inhibitors) and the tricyclic antidepressants (TCAs) act to raise noradrenaline. Furthermore, deficits in the NET gene have been associated with ADHD (Kim et al., 2006).

Long Name

Norepinephrine Transporter

Alternate Names

NAT1, Noradrenalin Transporter, Norepinephrine Transporter

Gene Symbol

SLC6A2

Additional SLC6A2/NET Products

Product Documents for SLC6A2/NET/Noradrenaline transporter Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SLC6A2/NET/Noradrenaline transporter Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SLC6A2/NET/Noradrenaline transporter Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SLC6A2/NET/Noradrenaline transporter Antibody - BSA Free and earn rewards!

Have you used SLC6A2/NET/Noradrenaline transporter Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...