SLC7A7 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-59856
Loading...
Key Product Details
Species Reactivity
Human
Applications
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
Synthetic peptides corresponding to SLC7A7(solute carrier family 7 (cationic amino acid transporter, y+ system), member 7) The peptide sequence was selected from the middle region of SLC7A7.
Peptide sequence WGTLVQDIFTYAKVLALIAVIVAGIVRLGQGASTHFENSFEGSSFAVGDI The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
56 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Scientific Data Images for SLC7A7 Antibody - BSA Free
Western Blot: SLC7A7 Antibody [NBP1-59856]
Western Blot: SLC7A7 Antibody [NBP1-59856] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.Western Blot: SLC7A7 Antibody [NBP1-59856]
Western Blot: SLC7A7 Antibody [NBP1-59856] - PANC1 cell lysate, concentration 0.2-1 ug/ml.Western Blot: SLC7A7 Antibody [NBP1-59856]
Western Blot: SLC7A7 Antibody [NBP1-59856] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.Western Blot: SLC7A7 Antibody - BSA Free [NBP1-59856] -
Expression level changes following overexpression and interference of SLC7A7 in PSCs. (A) The mRNA expression level of SLC7A7 after overexpression of SLC7A7; (B) the mRNA expression level of SLC7A7 after interference of SLC7A7; (C) protein expression level of SLC7A7 after overexpression of SLC7A7; (D) Quantification of Western blotting after overexpression of SLC7A7; (E) the protein expression level of SLC7A7 after interference of SLC7A7; (F) quantification of Western blotting after interference of SLC7A7. *, ** indicate significant difference at p < 0.05 and p < 0.01, respectively. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35054897), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: SLC7A7 Antibody - BSA Free [NBP1-59856] -
Expression level changes following overexpression and interference of SLC7A7 in PSCs. (A) The mRNA expression level of SLC7A7 after overexpression of SLC7A7; (B) the mRNA expression level of SLC7A7 after interference of SLC7A7; (C) protein expression level of SLC7A7 after overexpression of SLC7A7; (D) Quantification of Western blotting after overexpression of SLC7A7; (E) the protein expression level of SLC7A7 after interference of SLC7A7; (F) quantification of Western blotting after interference of SLC7A7. *, ** indicate significant difference at p < 0.05 and p < 0.01, respectively. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35054897), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: SLC7A7 Antibody - BSA Free [NBP1-59856] -
Effect of GCs on the amino acid transporter SLC7A7. (A) The mRNA expression levels of SLC7A7 in longissimus dorsi muscle of the cortisol group and the control group, respectively; (B) the mRNA expression levels of SLC7A7 after DEX treatment for 24 h and 48 h; (C) the protein expression levels of SLC7A7 after DEX treatment; (D): quantification of Western blotting under the treatment of DEX; (E) validation of m6A modification in SLC7A7 mRNA by MeRIP-QPCR; (F) the mRNA expression of SLC7A7 was detected at 0, 2 and 4 h after ActD treatment; (G) Dot blot detection of m6A modification levels after treatment with 0, 50, 100 and 200 μM DAA; (H) the mRNA expression level of SLC7A7 after treatment with 0, 50, 100 and 200 μM DAA; (I) the protein expression levels of SLC7A7 after treatment with 200 μM DAA; (J) quantification of Western blotting under the treatment of DAA. *, ** indicate significant difference at p < 0.05 and p < 0.01, respectively. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35054897), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for SLC7A7 Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: SLC7A7
Long Name
Solute Carrier Family 7 Member 7
Alternate Names
LAT3, LPI, MOP-2, Y+LAT1
Gene Symbol
SLC7A7
UniProt
Additional SLC7A7 Products
Product Documents for SLC7A7 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for SLC7A7 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for SLC7A7 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review SLC7A7 Antibody - BSA Free and earn rewards!
Have you used SLC7A7 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...