SMC3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35831

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot, ELISA, Immunoprecipitation

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 909-1199 of human SMC3 (NP_005436.1).

Sequence:
KEHMDAINHDTKELEKMTNRQGMLLKKKEECMKKIRELGSLPQEAFEKYQTLSLKQLFRKLEQCNTELKKYSHVNKKALDQFVNFSEQKEKLIKRQEELDRGYKSIMELMNVLELRKYEAIQLTFKQVSKNFSEVFQKLVPGGKATLVMKKGDVEGSQSQDEGEGSGESERGSGSQSSVPSVDQFTGVGIRVSFTGKQGEMREMQQLSGGQKSLVALALIFAIQKCDPAPFYLFDEIDQALDAQHRKAVSDMIMELAVHAQFITTTFRPELLESADKFYGVKFRNKVSHID

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

142 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for SMC3 Antibody - BSA Free

SMC3 Antibody

Western Blot: SMC3 Antibody [NBP3-35831] -

Western Blot: SMC3 Antibody [NBP3-35831] - Western blot analysis of various lysates using SMC3 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.
SMC3 Antibody

Immunoprecipitation: SMC3 Antibody [NBP3-35831] -

Immunoprecipitation: SMC3 Antibody [NBP3-35831] - Immunoprecipitation analysis of 600 ug extracts of Mouse spleen using 3 ug SMC3 antibody. Western blot was performed from the immunoprecipitate using SMC3 antibody at a dilution of 1:1000.

Applications for SMC3 Antibody - BSA Free

Application
Recommended Usage

Immunoprecipitation

0.5ug-4ug antibody for 400ug-600ug extracts of whole cells

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: SMC3

Involved in chromosome cohesion during cell cycle and in DNA repair. Central component of cohesin complex. The cohesin complex is required for the cohesion of sister chromatids after DNA replication. The cohesin complex apparently forms a large proteinaceous ring within which sister chromatids can be trapped. At anaphase, the complex is cleaved and dissociates from chromatin, allowing sister chromatids to segregate. The cohesin complex may also play a role in spindle pole assembly during mitosis and in chromosome movement.

Alternate Names

Bamacan, BAMSMC protein 3, Basement membrane-associated chondroitin proteoglycan, BMH, Chondroitin sulfate proteoglycan 6, chondroitin sulfate proteoglycan 6 (bamacan), Chromosome-associated polypeptide, CSPG6structural maintenance of chromosomes protein 3, hCAP, HCAPbamacan, SMC-3, SMC3L1CDLS3, structural maintenance of chromosomes 3

Gene Symbol

SMC3

Additional SMC3 Products

Product Documents for SMC3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SMC3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SMC3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SMC3 Antibody - BSA Free and earn rewards!

Have you used SMC3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...