SMEK2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-83882

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: GQTFKGLKTKYEQEKDRQNQKLNSVPSILRSNRFRRDAKALEEDEEMWFNEDEEEEGKAVMPPLE

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SMEK2 Antibody - BSA Free

Immunohistochemistry-Paraffin: SMEK2 Antibody [NBP1-83882]

Immunohistochemistry-Paraffin: SMEK2 Antibody [NBP1-83882]

Immunohistochemistry-Paraffin: SMEK2 Antibody [NBP1-83882] - Analysis in human fallopian tube and skeletal muscle tissues using NBP1-83882 antibody. Corresponding PPP4R38 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: SMEK2 Antibody [NBP1-83882]

Immunohistochemistry-Paraffin: SMEK2 Antibody [NBP1-83882]

Immunohistochemistry-Paraffin: SMEK2 Antibody [NBP1-83882] - Staining of human fallopian tube shows moderate to strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: SMEK2 Antibody [NBP1-83882]

Immunohistochemistry-Paraffin: SMEK2 Antibody [NBP1-83882]

Immunohistochemistry-Paraffin: SMEK2 Antibody [NBP1-83882] - Staining of human cerebral cortex shows weak to moderate nuclear positivity in neurons.
Immunohistochemistry-Paraffin: SMEK2 Antibody [NBP1-83882]

Immunohistochemistry-Paraffin: SMEK2 Antibody [NBP1-83882]

Immunohistochemistry-Paraffin: SMEK2 Antibody [NBP1-83882] - Staining of human testis shows moderate to strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: SMEK2 Antibody [NBP1-83882]

Immunohistochemistry-Paraffin: SMEK2 Antibody [NBP1-83882]

Immunohistochemistry-Paraffin: SMEK2 Antibody [NBP1-83882] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
SMEK2 Antibody - BSA Free Western Blot: SMEK2 Antibody - BSA Free [NBP1-83882]

Western Blot: SMEK2 Antibody - BSA Free [NBP1-83882]

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
SMEK2 Antibody - BSA Free Western Blot: SMEK2 Antibody - BSA Free [NBP1-83882]

Western Blot: SMEK2 Antibody - BSA Free [NBP1-83882]

Analysis in human cell line HDLM-2.
SMEK2 Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: SMEK2 Antibody [NBP1-83882]

Immunocytochemistry/ Immunofluorescence: SMEK2 Antibody [NBP1-83882]

Staining of human cell line U-251 MG shows localization to nucleoplasm & centrosome.

Applications for SMEK2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SMEK2

Regulatory subunit of serine/threonine-protein phosphatase 4 (PP4). May regulate the activity of PPP4C atcentrosomal microtubule organizing centers

Alternate Names

FLFL2, FLJ31474, KIAA1387serine/threonine-protein phosphatase 4 regulatory subunit 3B, PP4R3B, PPP4R3B, PSY2, SMEK homolog 2, SMEK homolog 2, suppressor of mek1 (Dictyostelium), smk1

Gene Symbol

SMEK2

Additional SMEK2 Products

Product Documents for SMEK2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SMEK2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for SMEK2 Antibody - BSA Free

Customer Reviews for SMEK2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SMEK2 Antibody - BSA Free and earn rewards!

Have you used SMEK2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...